Na(+)-translocating NADH-quinone reductase subunit D in PDB entry 7xk7 ‹ PDBe

Chain: D
Length: 210 amino acids
Theoretical weight: 22.85 KDa
Source organism: Vibrio cholerae O395
Expression system: Vibrio cholerae
UniProt:

Canonical: A5F5Y6 (Residues: 1-210; Coverage: 100%)

Gene names: VC0395_A1881, VC395_2408, nqrD
FASTA Sequence


    >pdb|7xk7|D

MSSAKELKKSVLAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVMFVTALSNFFVSLIRNHIPNSVRIIVQMAIIASLVIVVDQILKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSEPIPSFIDGIGNGLGYGFVLMTVGFFRELLGSGKLFGLEVLPLISNGGWYQPNGLMLLAPSAFFLIGFMIWAIRTFKPEQVEAKE

7xk7:D

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.