PDBe-KB: UniProt Coverage View:
G0SAE9
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 in PDB entry 7zm7, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/7zm7_entity_7_front_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zm7</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 in PDB entry 7zm7, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/7zm7_entity_7_side_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zm7</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 in PDB entry 7zm7, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/7zm7_entity_7_top_image-200x200.png "Hetero 43-meric assembly 1 of PDB entry <span class='highlight'>7zm7</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7</span>. Top view.")
Chain: 8
Length: 86 amino acids
Theoretical weight: 10.31 KDa
Source organism: Thermochaetoides thermophila DSM 1495
UniProt:
FASTA Sequence
Length: 86 amino acids
Theoretical weight: 10.31 KDa
Source organism: Thermochaetoides thermophila DSM 1495
UniProt:
- Canonical: G0SAE9 (Residues: 1-86; Coverage: 100%)
FASTA Sequence
>pdb|7zm7|8
MATDAAETSRRATREEMRDAKVPLAYRDSCAHLLIPLNRCRYETYYLPWKCEDERHSYEKCQYLEFKKRVQKMEELREAKGGARSN
PDBe-KB: UniProt Coverage View:
G0SAE9