› › Subunit NDUFB2 of NADH-ubiquinone oxidoreductase (Complex I)

Subunit NDUFB2 of NADH-ubiquinone oxidoreductase (Complex I) in PDB entry 7zm8, assembly 1, front view.
Subunit NDUFB2 of NADH-ubiquinone oxidoreductase (Complex I) in PDB entry 7zm8, assembly 1, side view.
Subunit NDUFB2 of NADH-ubiquinone oxidoreductase (Complex I) in PDB entry 7zm8, assembly 1, top view.
Chain: e
Length: 46 amino acids
Theoretical weight: 5.28 KDa
Source organism: Thermochaetoides thermophila DSM 1495
FASTA Sequence
>pdb|7zm8|e
MAGGGQHVSRVHRFLATGLGASMWFWIFYRAKKDGPVLLGWKHPWD

Quick links

Search similar proteins