![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 8bpx, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_17_front_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 8bpx, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_17_side_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 8bpx, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_17_top_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Top view.")
Chain: Q
Length: 154 amino acids
Theoretical weight: 17.16 KDa
Source organism: Arabidopsis thaliana
UniProt:
FASTA Sequence
Length: 154 amino acids
Theoretical weight: 17.16 KDa
Source organism: Arabidopsis thaliana
UniProt:
- Canonical:
Q9FJW4 (Residues: 1-154; Coverage: 100%)
FASTA Sequence
>pdb|8bpx|Q
MALCATTQRTIRIAATLRRVARPFATDAVVESDYKRGEIGKVSGIPEEHLSRKVIIYSPARTATQSGSGKLGKWKINFVSTLKWENPLMGWTSTGDPYANVGDSALAFDSEEAAKSFAERHGWDYKVKKPNTPLLKVKSYSDNFKWKGNPQPEN