PDBe-KB: UniProt Coverage View:
Q9FGK0
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 8bpx, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_37_front_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 8bpx, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_37_side_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial in PDB entry 8bpx, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8bpx_entity_37_top_image-200x200.png "Hetero 67-meric assembly 1 of PDB entry <span class='highlight'>8bpx</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial</span>. Top view.")
Chain: l
Length: 125 amino acids
Theoretical weight: 13.23 KDa
Source organism: Arabidopsis thaliana
UniProt:
FASTA Sequence
Length: 125 amino acids
Theoretical weight: 13.23 KDa
Source organism: Arabidopsis thaliana
UniProt:
- Canonical: Q9FGK0 (Residues: 1-125; Coverage: 100%)
FASTA Sequence
>pdb|8bpx|l
MAGRLSGVASRIMGGNGVVARSVGSSLRQRAGMGLPVGKHIVPDKPLSVNDELMWDNGTAFPEPCIDRIADTVGKYEALAWLSGGLGFFVGLGLLAVLNDKASKVPFTPRVYPYDNLRVELGGEP
PDBe-KB: UniProt Coverage View:
Q9FGK0