Small ribosomal subunit protein uS12A in PDB entry 8cbj ‹ PDBe

Chain: X
Length: 145 amino acids
Theoretical weight: 16.07 KDa
Source organism: Saccharomyces cerevisiae W303
UniProt:

Canonical: P0CX29 (Residues: 1-145; Coverage: 100%)

Gene names: G6178, RPS23A, RPS28A, YGR118W
FASTA Sequence


    >pdb|8cbj|X

MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS

PDBe-KB: UniProt Coverage View: P0CX29

Loading Protvista...

8cbj:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.