Interleukin-17A in PDB entry 8dy1 ‹ PDBe

Chains: A, B
Length: 122 amino acids
Theoretical weight: 14.21 KDa
Source organism: Homo sapiens
Expression system: Homo sapiens
UniProt:

Canonical: Q16552 (Residues: 35-155; Coverage: 92%)

Gene names: CTLA8, IL17, IL17A
FASTA Sequence


    >pdb|8dy1|A B

MNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAQCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHSPNSFRLEKILVSVGCTCVTPIVHHVQ

8dy1:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.