› › Heavy chain of YN7114-08 Fab

Heavy chain of YN7114-08 Fab in PDB entry 8j7v, assembly 1, front view.
Heavy chain of YN7114-08 Fab in PDB entry 8j7v, assembly 1, side view.
Heavy chain of YN7114-08 Fab in PDB entry 8j7v, assembly 1, top view.
Chains: E, F
Length: 234 amino acids
Theoretical weight: 24.97 KDa
Source organism: Mus musculus
Expression system: Mus musculus
FASTA Sequence
>pdb|8j7v|E F
EVQLQESGPGLVAPSQSLSITCTVSGFSLTNYAVHWVRQSPGKGLEWLGVIWSNGRTDYNAAFISRLSISKDNSKSQVFFKMNSLQADDTAIYYCARKLAYEGAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSS
123420406080100120140160180200220
 
100200
Chains
Chain C (auth E)
Chain E (auth F)
Secondary structure
Interaction interfaces
Sequence conservation
 
NC
 
  8j7v:E 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins