PDBe-KB: UniProt Coverage View:
Q02379
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 8q47, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8q47_entity_30_front_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8q47</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 8q47, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8q47_entity_30_side_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8q47</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 in PDB entry 8q47, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8q47_entity_30_top_image-200x200.png "Hetero 45-meric assembly 1 of PDB entry <span class='highlight'>8q47</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 5</span>. Top view.")
Chain: e
Length: 106 amino acids
Theoretical weight: 12.69 KDa
Source organism: Bos taurus
UniProt:
FASTA Sequence
Length: 106 amino acids
Theoretical weight: 12.69 KDa
Source organism: Bos taurus
UniProt:
- Canonical: Q02379 (Residues: 1-106; Coverage: 100%)
FASTA Sequence
>pdb|8q47|e
MPFFDVQKRLGVDLDRWMTIQSAEQPHKIPSRCHAFEKEWIECAHGIGSIRAEKECKIEFEDFRECLLRQKTMKRLHAIRRQREKLIKEGKYTPPPHHSGQEEPRS
PDBe-KB: UniProt Coverage View:
Q02379