Myoglobin in PDB entry 8r8y ‹ PDBe

Chain: A
Length: 152 amino acids
Theoretical weight: 16.93 KDa
Source organism: Equus caballus
UniProt:

Canonical: P68082 (Residues: 2-153; Coverage: 99%)

Gene name: MB
FASTA Sequence


    >pdb|8r8y|A

GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ

PDBe-KB: UniProt Coverage View: P68082

Loading Protvista...

8r8y:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.