PDBe-KB: UniProt Coverage View:
A0A4X1THU2
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8ugj, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/8ugj_entity_18_front_image-200x200.png "Hetero 95-meric assembly 1 of PDB entry <span class='highlight'>8ugj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8ugj, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/8ugj_entity_18_side_image-200x200.png "Hetero 95-meric assembly 1 of PDB entry <span class='highlight'>8ugj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial in PDB entry 8ugj, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/8ugj_entity_18_top_image-200x200.png "Hetero 95-meric assembly 1 of PDB entry <span class='highlight'>8ugj</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial</span>. Top view.")
Chain: 1R
Length: 123 amino acids
Theoretical weight: 13.35 KDa
Source organism: Sus scrofa
UniProt:
FASTA Sequence
Length: 123 amino acids
Theoretical weight: 13.35 KDa
Source organism: Sus scrofa
UniProt:
- Canonical: A0A4X1THU2 (Residues: 1-123; Coverage: 100%)
FASTA Sequence
>pdb|8ugj|1R
MAAVTFLRLLGRSGAGARNLLGGSRCFGVRTSPTGEKVTHTGQAYDDGDYRRVRFSDRQKEVNENFAIDLIAEQPVSEVGSRVISCDGGGGALGHPRVYINLDKETKTGTCGYCGLQFRQPHH
PDBe-KB: UniProt Coverage View:
A0A4X1THU2