› › Heavy chain of Ab17

Heavy chain of Ab17 in PDB entry 8w5m, assembly 1, front view.
Heavy chain of Ab17 in PDB entry 8w5m, assembly 1, side view.
Heavy chain of Ab17 in PDB entry 8w5m, assembly 1, top view.
Chain: H
Length: 124 amino acids
Theoretical weight: 13.61 KDa
Source organism: Mus musculus
Expression system: Homo sapiens
FASTA Sequence
>pdb|8w5m|H
VHSEVQLVESGGGLVKPGGSLKLSCAASGFTFSDYGMHWVRRAPEKGLEWISYISSGGSTIYYADTVKGRFTISGDNAKNTLFLQMTSLRSEDTAMYFCARRGYDGHHYFDYWGQGTTLTVSSA
1124102030405060708090100110120
 
50100
Chains
Chain B (auth H)
Interaction interfaces
Sequence conservation
 
NC
 
  8w5m:H 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins