› › M-alpha

M-alpha in PDB entry 9jsw, assembly 1, front view.
M-alpha in PDB entry 9jsw, assembly 1, side view.
M-alpha in PDB entry 9jsw, assembly 1, top view.
Chains: A, B, C, D, E, F, G, H
Length: 35 amino acids
Theoretical weight: 3.84 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P40967 (Residues: 148-182; Coverage: 6%)
Gene names: D12S53E, PMEL, PMEL17, SILV
FASTA Sequence
>pdb|9jsw|A B C D E F G H
SFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTH
PDBe-KB: UniProt Coverage View: P40967  
1355101520253035
 
102030SFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTH
UniProt
P40967
Chains
Interaction interfaces
Sequence conservation
Topology Data Not Available!
 
 
  9jsw:A 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Quick links

Search similar proteins