YALI0F06061p (B5RSK9)

Macromolecular Interactions
Interacting Partners (10)
This section shows macromolecules observed together with the protein of interest in PDB entries. Click on the images to see the related PDB entries. The interaction partner is colored blue.
Download
Click to download files
Click to download annotations in .csv format

Rotate your device or view on a larger screen to see additional information

Filter the molecules:   
Filter by molecule name, code or PDB id.

In the gallery below, the structure of the protein of interest (i.e. the protein this page focuses on) is colored grey, while the interaction partner (i.e. the macromolecule the gallery item focuses on) is colored blue.

Interface Residues

The visualisation is using UniProt numbering for residues, not PDB numbering.

193102030405060708090
 
20406080MVELKPSSAIQRGPLNKGGWDAPHALHNDGAIDRYAHWRTFYQERFKYTRATGKSTLIFLVAFPALIGYVAYQSEGLFEFAGKRRGESVTTRG
Interaction interfaces
NADH-ubiquinone oxidoreductase chain 4 (Q9B6D6)
NADH-ubiquinone oxidoreductase chain 5 (Q9B6D3)
YALI0D04939p (Q6CA88)
NADH-ubiquinone oxidoreductase chain 2 (Q9B6C8)
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 (Q6C9Z1)
Uncharacterized protein (A0A1H6Q311)
YALI0A17946p (B5RSK3)
YALI0F17248p (F2Z626)
YALI0E11891p (Q6C674)
YALI0E29095p (F2Z673)