Cytochrome c oxidase subunit 6C (P04038)

Structures and Domains
The visualisation below shows information on protein structures covering various regions of the sequence, domains (Pfam, CATH, SCOP and InterPro), known secondary structural elements content and predicted intrinsic flexibility of the protein. It also shows all the theoretical structures available for this protein.
Download
Click to download files
Click to download annotations in .csv format
View
View all the superposed structural clusters of this protein

Rotate your device or view on a larger screen to see additional information

PDB Chain shown: 6jy3 I go to PDBe

Tap any buttons in the table below to display a different structures.

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

PDB Chain shown: 6jy3 I go to PDBe

Help: Click on any PDB and Other Structures segment (i.e. coloured box) on the ProtVista sequence feature viewer below to display a different structure. The visualisation is using UniProt numbering for residues, not PDB numbering.

17410203040506070
 
204060MSTALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK
PDB Structures (83)
6jy3 1.85Å
6jy4 1.95Å
7coh 1.3Å
5b1b 1.6Å
8h8r 1.7Å
8h8s 1.7Å
7ev7 1.7Å
7vuw 1.6Å
7w3e 1.45Å
7d5x 1.74Å
7ypy 1.5Å
7vvr 1.65Å
5xdq 1.77Å
7d5w 1.84Å
7cp5 1.76Å
6juw 1.8Å
5z86 1.85Å
3ag2 1.8Å
5b3s 1.68Å
7xmb 2.2Å
7xma 2.2Å
8gvm 1.85Å
7thu 1.93Å
7tie 1.9Å
5b1a 1.5Å
5xdx 1.99Å
8ijn 1.8Å
5zcq 1.65Å
5zcp 1.65Å
2dyr 1.8Å
6j8m 1.9Å
5z84 1.85Å
5wau 1.95Å
3ag3 1.8Å
5z85 1.85Å
7y44 1.9Å
7tih 2.35Å
5zco 1.9Å
3x2q
1v55 1.9Å
3abl 2.1Å
1v54 1.8Å
3wg7 1.9Å
3abm 1.95Å
2eij 1.9Å
3aso 2.3Å
5x19 2.2Å
5x1f 2.2Å
2dys 2.2Å
5w97 2.3Å
3abk
2eik 2.1Å
3ag4 2.05Å
5iy5
7tii 2.45Å
2eil 2.1Å
6nkn 2.5Å
2y69 1.95Å
3ag1 2.2Å
2zxw 2.5Å
5x1b 2.4Å
3asn
6nmf 2.8Å
8gcq 2.38Å
2occ 2.3Å
1ocr 2.35Å
6nmp 2.9Å
8gbt 2.8Å
2eim 2.6Å
8d4t 3.1Å
2ein 2.7Å
1oco 2.8Å
1occ 2.8Å
1ocz 2.9Å
5xth 3.9Å
7dgr 4.6Å
7dgq
5gpn 5.4Å
7dgs 7.8Å
7dkf 8.3Å
5luf 9.1Å
5xti 17.4Å
2ybb 19Å
Flexibility predictions
Early folding residue predictions
Domains
Other structures (3)
Other : Observed Unobserved Conflict
Flexibility predictions : WEBnma DynaMine
Early folding residue predictions : EFoldMine
Domains : CATH domains InterPro annotations
PDB IDUniProt Range
6jy3 1.85Å 2 - 74
6jy4 1.95Å 2 - 74
7coh 1.3Å 2 - 74
5b1b 1.6Å 2 - 2
8h8r 1.7Å 2 - 74
8h8s 1.7Å 2 - 74