Small ribosomal subunit protein bS20 (P9WH41)

Ligands and Environments
Directly Interacting Ligands (1)
This is the count of unique ligands observed to directly interact with the protein of interest in any PDB entries.

All Ligands (7)
This is the count of all the unique ligands observed in any PDB entries the protein of interest is also found in. Note that not all of these small molecules may directly interact with the protein.
This section, by default, shows ligands observed directly bound to the protein of interest, if such ligands are available. Click on the checkbox below to see every ligand from all PDB entries (some may not directly interact with the protein). If there are no directly interacting ligands, all ligands will be shown by default. Click on the images to see the related PDB entries. For ligand binding residues, see the sequence viewer at the bottom.
Download
Click to download files
Click to download annotations in .csv format
View
View all the ligands superposed on this protein

Rotate your device or view on a larger screen to see additional information

Filter the ligands:   
Filter by molecule name, code or PDB id.

Show all ligands from PDB entries containing this protein:
Help: Checking this box will show ligands which may not directly interact with the protein.
Legends: Annotated small molecules Ligands with green-bordered boxes have annotations such as cofactor-like, reactant-like or drug-like.
Other small molecules Ligands with black-bordered boxes have no additional annotations.
Not interacting small molecules Ligands with grey-bordered boxes do not directly interact with the protein of interest.
Ligand-binding Residues

The visualisation is using UniProt numbering for residues, not PDB numbering.

1861020304050607080
 
20406080MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDKAASKGVIHKNQAANKKSALAQALNKL
Ligand binding sites
MG