Large ribosomal subunit protein eL43 (Q5JDM6)

Structures and Domains
The visualisation below shows information on protein structures covering various regions of the sequence, domains (Pfam, CATH, SCOP and InterPro), known secondary structural elements content and predicted intrinsic flexibility of the protein. It also shows all the theoretical structures available for this protein.
Download
Click to download files
Click to download annotations in .csv format
View
View all the superposed structural clusters of this protein

Rotate your device or view on a larger screen to see additional information

PDB Chain shown: 6skg GB go to PDBe

Tap any buttons in the table below to display a different structures.

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

PDB Chain shown: 6skg GB go to PDBe

Help: Click on any PDB and Other Structures segment (i.e. coloured box) on the ProtVista sequence feature viewer below to display a different structure. The visualisation is using UniProt numbering for residues, not PDB numbering.

1861020304050607080
 
20406080MGRTTKVGSAGRFGPRYGLKIRRRVAAVEARMKQKHVCPVCGRKAVRRISTGIWQCQKCGATFAGGAYLPTTPAGKVAKRVTASKA
PDB Structures (3)
6skg 2.65Å
6th6 2.55Å
6skf 2.95Å
Domains
Other structures (3)
Other : Observed Unobserved
Domains : InterPro annotations
PDB IDUniProt Range
6skg 2.65Å 1 - 86
6th6 2.55Å 1 - 86
6skf 2.95Å 1 - 86