GET /api/structure/PDB/entry/InterPro/IPR001421/?page_size=20
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "count": 35,
    "next": "https://www.ebi.ac.uk/interpro/api/structure/PDB/entry/InterPro/IPR001421/?cursor=source%3As%3A7aje&page_size=20",
    "previous": null,
    "results": [
        {
            "metadata": {
                "accession": "6j54",
                "name": "Cryo-EM structure of the mammalian E-state ATP synthase FO section",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.94
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 5,
                                    "auth_end": 34
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "DTSTWFITITSMIMTLFILFQLKISNYSYP",
                    "sequence_length": 30,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6j5a",
                "name": "Cryo-EM structure of the mammalian DP-state ATP synthase FO section",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 4.35
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 5,
                                    "auth_end": 34
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "DTSTWFITITSMIMTLFILFQLKISNYSYP",
                    "sequence_length": 30,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6j5i",
                "name": "Cryo-EM structure of the mammalian DP-state ATP synthase",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.34
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6j5j",
                "name": "Cryo-EM structure of the mammalian E-state ATP synthase",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.45
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6j5k",
                "name": "Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 6.2
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "B8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "C8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6tt7",
                "name": "Ovine ATP synthase 1a state",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.5
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "Q",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL",
                    "sequence_length": 66,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6za9",
                "name": "Fo domain of Ovine ATP synthase",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.76
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "Q",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL",
                    "sequence_length": 66,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zbb",
                "name": "bovine ATP synthase Fo domain",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.61
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6ziq",
                "name": "bovine ATP synthase stator domain, state 1",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 4.33
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zit",
                "name": "bovine ATP synthase Stator domain, state 2",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.49
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6ziu",
                "name": "bovine ATP synthase stator domain, state 3",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 6.02
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zmr",
                "name": "Porcine ATP synthase Fo domain",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.94
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 67,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": "q35914"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zna",
                "name": "Porcine ATP synthase Fo domain",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 6.2
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 67,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": "q35914"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 67,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": "q35914"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 67,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "B8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": "q35914"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 67,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "C8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
                    "sequence_length": 67,
                    "protein": "q35914"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zpo",
                "name": "bovine ATP synthase monomer state 1 (combined)",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 4.0
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zqm",
                "name": "bovine ATP synthase monomer state 2 (combined)",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.29
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6zqn",
                "name": "bovine ATP synthase monomer state 3 (combined)",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 4.0
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "7ajb",
                "name": "bovine ATP synthase dimer state1:state1",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 9.2
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "7ajc",
                "name": "bovine ATP synthase dimer state1:state2",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 11.9
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "7ajd",
                "name": "bovine ATP synthase dimer state1:state3",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 9.0
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        },
        {
            "metadata": {
                "accession": "7aje",
                "name": "bovine ATP synthase dimer state2:state1",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 9.4
            },
            "entries": [
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                },
                {
                    "accession": "IPR001421",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 66,
                    "source_database": "interpro",
                    "entry_type": "family",
                    "entry_integrated": null,
                    "chain": "A8",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 55,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
                    "sequence_length": 66,
                    "protein": "p03929"
                }
            ]
        }
    ]
}