General Handler
GET /api/structure/PDB/entry/pfam/PF13408/?page_size=20
{
"count": 3,
"next": null,
"previous": null,
"results": [
{
"metadata": {
"accession": "4kis",
"name": "Crystal Structure of a LSR-DNA Complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.2
},
"entries": [
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": 267,
"auth_end": 333
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": 267,
"auth_end": 333
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": 267,
"auth_end": 333
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": 267,
"auth_end": 333
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
}
]
},
{
"metadata": {
"accession": "5udo",
"name": "Crystal structure of the coiled-coil domain from Listeria Innocua Phage Integrase (Tetragonal Form II)",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.541
},
"entries": [
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "E",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "F",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "G",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
},
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "H",
"entry_structure_locations": [
{
"fragments": [
{
"start": 135,
"end": 201,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
"sequence_length": 328,
"protein": "q928v6"
}
]
},
{
"metadata": {
"accession": "6dnw",
"name": "Sequence Requirements of the Listeria innocua prophage attP site",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.849
},
"entries": [
{
"accession": "PF13408",
"entry_protein_locations": [
{
"fragments": [
{
"start": 267,
"end": 333,
"dc-status": "CONTINUOUS"
}
],
"representative": true,
"model": "PF13408",
"score": 1.1e-08
}
],
"protein_length": 452,
"source_database": "pfam",
"entry_type": "domain",
"entry_integrated": "ipr025827",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 134,
"end": 200,
"dc-status": "CONTINUOUS",
"auth_start": 267,
"auth_end": 333
}
],
"representative": true,
"model": "PF13408",
"score": null
}
],
"sequence": "DRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWL",
"sequence_length": 319,
"protein": "q928v6"
}
]
}
]
}