GET /api/structure/PDB/entry/prints/PR01161/?page_size=20
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "count": 704,
    "next": "https://www.ebi.ac.uk/interpro/api/structure/PDB/entry/prints/PR01161/?cursor=source%3As%3A3du7&page_size=20",
    "previous": null,
    "results": [
        {
            "metadata": {
                "accession": "1ffx",
                "name": "TUBULIN:STATHMIN-LIKE DOMAIN COMPLEX",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.95
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": null
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": null
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": null
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [],
                    "protein_length": null,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": null
                }
            ]
        },
        {
            "metadata": {
                "accession": "1ia0",
                "name": "KIF1A HEAD-MICROTUBULE COMPLEX STRUCTURE IN ATP-FORM",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 15.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.71e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p02550"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.46e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "p02554"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1jff",
                "name": "Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.5
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p81947"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1sa0",
                "name": "TUBULIN-COLCHICINE: STATHMIN-LIKE DOMAIN COMPLEX",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.58
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1sa1",
                "name": "Tubulin-podophyllotoxin: stathmin-like domain complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 4.2
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1tub",
                "name": "TUBULIN ALPHA-BETA DIMER, ELECTRON DIFFRACTION",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 3.7
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.71e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV",
                    "sequence_length": 440,
                    "protein": "p02550"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.46e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD",
                    "sequence_length": 427,
                    "protein": "p02554"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1tvk",
                "name": "The binding mode of epothilone A on a,b-tubulin by electron crystallography",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 2.89
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV",
                    "sequence_length": 440,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 51,
                                    "auth_end": 70
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 93,
                                    "auth_end": 104
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 106,
                                    "auth_end": 130
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 132,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 151,
                                    "auth_end": 172
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 176,
                                    "auth_end": 189
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 190,
                                    "auth_end": 210
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 370,
                                    "auth_end": 398
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD",
                    "sequence_length": 427,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1z2b",
                "name": "Tubulin-colchicine-vinblastine: stathmin-like domain complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 4.1
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE",
                    "sequence_length": 448,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE",
                    "sequence_length": 448,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1z5v",
                "name": "Crystal structure of human gamma-tubulin bound to GTPgammaS",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.71
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.32e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.89e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.96e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.22e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.06e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.71e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.82e-08
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 11,
                                    "auth_end": 31
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 52,
                                    "auth_end": 71
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 179,
                                    "auth_end": 192
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 193,
                                    "auth_end": 213
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQVDVDGGEQKLISEEDLLLEHHHHHH",
                    "sequence_length": 474,
                    "protein": "p23258"
                }
            ]
        },
        {
            "metadata": {
                "accession": "1z5w",
                "name": "Crystal Structure of gamma-tubulin bound to GTP",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.32e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.89e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.96e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.22e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.06e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.71e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.82e-08
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 11,
                                    "auth_end": 31
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 52,
                                    "auth_end": 71
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 179,
                                    "auth_end": 192
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 193,
                                    "auth_end": 213
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQVDVDGGEQKLISEEDLLLEHHHHHH",
                    "sequence_length": 474,
                    "protein": "p23258"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2bto",
                "name": "Structure of BtubA from Prosthecobacter dejongeii",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.5
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.11e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.23e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.00248
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.000472
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.37e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.04e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.12e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.01e-10
                        }
                    ],
                    "protein_length": 473,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 12,
                                    "auth_end": 32
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 56,
                                    "auth_end": 75
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 97,
                                    "auth_end": 108
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 110,
                                    "auth_end": 134
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 136,
                                    "auth_end": 154
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 155,
                                    "auth_end": 176
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 180,
                                    "auth_end": 193
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 194,
                                    "auth_end": 214
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 375,
                                    "auth_end": 403
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
                    "sequence_length": 473,
                    "protein": "q8gcc5"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.11e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.23e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.00248
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.000472
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.37e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.04e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.12e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.01e-10
                        }
                    ],
                    "protein_length": 473,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 12,
                                    "auth_end": 32
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 56,
                                    "auth_end": 75
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 97,
                                    "auth_end": 108
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 110,
                                    "auth_end": 134
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 136,
                                    "auth_end": 154
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 155,
                                    "auth_end": 176
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 194,
                                    "auth_end": 214
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 375,
                                    "auth_end": 403
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
                    "sequence_length": 473,
                    "protein": "q8gcc5"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2btq",
                "name": "Structure of BtubAB heterodimer from Prosthecobacter dejongeii",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.2
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.11e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.23e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.00248
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.000472
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.37e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.04e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.12e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.01e-10
                        }
                    ],
                    "protein_length": 473,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 12,
                                    "end": 32,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 12,
                                    "auth_end": 32
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 56,
                                    "end": 75,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 56,
                                    "auth_end": 75
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 97,
                                    "end": 108,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 97,
                                    "auth_end": 108
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 110,
                                    "end": 134,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 110,
                                    "auth_end": 134
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 136,
                                    "end": 154,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 136,
                                    "auth_end": 154
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 155,
                                    "end": 176,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 155,
                                    "auth_end": 176
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 180,
                                    "end": 193,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 180,
                                    "auth_end": 193
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 194,
                                    "end": 214,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 194,
                                    "auth_end": 214
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 375,
                                    "end": 403,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 375,
                                    "auth_end": 403
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
                    "sequence_length": 473,
                    "protein": "q8gcc5"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.37e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.22e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 94,
                                    "end": 105,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.8e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 107,
                                    "end": 131,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 0.000129
                        },
                        {
                            "fragments": [
                                {
                                    "start": 133,
                                    "end": 151,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 152,
                                    "end": 173,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 6.29e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 177,
                                    "end": 190,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.62e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 191,
                                    "end": 211,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.9e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.28e-11
                        }
                    ],
                    "protein_length": 426,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 52,
                                    "auth_end": 71
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 94,
                                    "end": 105,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 94,
                                    "auth_end": 105
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 107,
                                    "end": 131,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 107,
                                    "auth_end": 131
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 133,
                                    "end": 151,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 133,
                                    "auth_end": 151
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 152,
                                    "end": 173,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 152,
                                    "auth_end": 173
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 177,
                                    "end": 190,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 177,
                                    "auth_end": 190
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 191,
                                    "end": 211,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 191,
                                    "auth_end": 211
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 370,
                                    "auth_end": 398
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "VREILSIHVGQCGNQIADSFWRLALREHGLTEAGTLKEGSNAAANSNMEVFFHKVRDGKYVPRAVLVDLEPGVIARIEGGDMSQLFDESSIVRKIPGAANNWARGYNVEGEKVIDQIMNVIDSAVEKTKGLQGFLMTHSIGGGSGSGLGSLILERLRQAYPKKRIFTFSVVPSPLISDSAVEPYNAILTLQRILDNADGAVLLDNEALFRIAKAKLNRSPNYMDLNNIIALIVSSVTASLRFPGKLNTDLSEFVTNLVPFPGNHFLTASFAPMRGAGQEGQVRTNFPDLARETFAQDNFTAAIDWQQGVYLAASALFRGDVKAKDVDENMATIRKSLNYASYMPASGGLKLGYAETAPEGFASSGLALVNHTGIAAVFERLIAQFDIMFDNHAYTHWYENAGVSRDMMAKARNQIATLAQSYRDAS",
                    "sequence_length": 426,
                    "protein": "q8gcc1"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2hxf",
                "name": "KIF1A head-microtubule complex structure in amppnp-form",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 10.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.71e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p02550"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.46e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "p02554"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2hxh",
                "name": "KIF1A head-microtubule complex structure in adp-form",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 11.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.71e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p02550"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.46e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "p02554"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2p4n",
                "name": "Human Monomeric Kinesin (1BG2) and Bovine Tubulin (1JFF) Docked into the 9-Angstrom Cryo-EM Map of Nucleotide-Free Kinesin Complexed to the Microtubule",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 9.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.71e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p02550"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2wbe",
                "name": "Kinesin-5-Tubulin Complex with AMPPNP",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 9.4
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2xrp",
                "name": "Human Doublecortin N-DC Repeat (1MJD) and Mammalian Tubulin (1JFF and 3HKE) Docked into the 8-Angstrom Cryo-EM Map of Doublecortin- Stabilised Microtubules",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 8.2
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
                    "sequence_length": 452,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
                    "sequence_length": 452,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "E",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "F",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
                    "sequence_length": 452,
                    "protein": "q2hj86"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "G",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.31e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.95e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.51e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "H",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
                    "sequence_length": 452,
                    "protein": "q2hj86"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3cb2",
                "name": "Crystal structure of human gamma-tubulin bound to GDP",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.303
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.32e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.89e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.96e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.22e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.06e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.71e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.82e-08
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 11,
                                    "auth_end": 31
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 52,
                                    "auth_end": 71
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 96,
                                    "auth_end": 107
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 179,
                                    "auth_end": 192
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 193,
                                    "auth_end": 213
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQVDVDGGQKLISEEDLLLEHHHHHH",
                    "sequence_length": 475,
                    "protein": "p23258"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.32e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.89e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.96e-05
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 3.22e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.06e-10
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.27e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 4.71e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.82e-08
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 11,
                                    "end": 31,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 11,
                                    "auth_end": 31
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 52,
                                    "end": 71,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 52,
                                    "auth_end": 71
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 96,
                                    "end": 107,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 96,
                                    "auth_end": 107
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 179,
                                    "end": 192,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 179,
                                    "auth_end": 192
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 193,
                                    "end": 213,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 193,
                                    "auth_end": 213
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQVDVDGGQKLISEEDLLLEHHHHHH",
                    "sequence_length": 475,
                    "protein": "p23258"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3dco",
                "name": "Drosophila NOD (3DC4) and Bovine Tubulin (1JFF) Docked into the 11-Angstrom Cryo-EM Map of Nucleotide-Free NOD Complexed to the Microtubule",
                "source_database": "pdb",
                "experiment_type": "em",
                "resolution": 11.0
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.29e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.37e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.49e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.92e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.22e-15
                        }
                    ],
                    "protein_length": 451,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
                    "sequence_length": 451,
                    "protein": "p81947"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3du7",
                "name": "Tubulin-colchicine-phomopsin A: Stathmin-like domain complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 4.1
            },
            "entries": [
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.26e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.25e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.46e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.9e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-15
                        }
                    ],
                    "protein_length": 449,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDLVLDRVRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMSQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSYEDEDEGEEY",
                    "sequence_length": 449,
                    "protein": "q3zcj7"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.34e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 8.26e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-06
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.25e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.04e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.46e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.54e-07
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.9e-11
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.55e-15
                        }
                    ],
                    "protein_length": 449,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 53,
                                    "end": 72,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 95,
                                    "end": 106,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 108,
                                    "end": 132,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 153,
                                    "end": 174,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 178,
                                    "end": 191,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 192,
                                    "end": 212,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 380,
                                    "end": 408,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDLVLDRVRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMSQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSYEDEDEGEEY",
                    "sequence_length": 449,
                    "protein": "q3zcj7"
                },
                {
                    "accession": "PR01161",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.46e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1.11e-12
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 2.97e-08
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.77e-16
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.11e-15
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 5.19e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 9.81e-09
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 7.15e-13
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": 1e-16
                        }
                    ],
                    "protein_length": 445,
                    "source_database": "prints",
                    "entry_type": "family",
                    "entry_integrated": "ipr000217",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 10,
                                    "end": 30,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 10,
                                    "auth_end": 30
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 51,
                                    "end": 70,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 53,
                                    "auth_end": 72
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 93,
                                    "end": 104,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 95,
                                    "auth_end": 106
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 106,
                                    "end": 130,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 108,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 132,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 134,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 151,
                                    "end": 172,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 153,
                                    "auth_end": 174
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 176,
                                    "end": 189,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 178,
                                    "auth_end": 191
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 190,
                                    "end": 210,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 192,
                                    "auth_end": 212
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        },
                        {
                            "fragments": [
                                {
                                    "start": 370,
                                    "end": 398,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 380,
                                    "auth_end": 408
                                }
                            ],
                            "representative": false,
                            "model": "PR01161",
                            "score": null
                        }
                    ],
                    "sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
                    "sequence_length": 445,
                    "protein": "q6b856"
                }
            ]
        }
    ]
}