HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"count": 704,
"next": "https://www.ebi.ac.uk/interpro/api/structure/PDB/entry/prints/PR01161/?cursor=source%3As%3A3du7&page_size=20",
"previous": null,
"results": [
{
"metadata": {
"accession": "1ffx",
"name": "TUBULIN:STATHMIN-LIKE DOMAIN COMPLEX",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.95
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": null
},
{
"accession": "PR01161",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": null
},
{
"accession": "PR01161",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": null
},
{
"accession": "PR01161",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": null
}
]
},
{
"metadata": {
"accession": "1ia0",
"name": "KIF1A HEAD-MICROTUBULE COMPLEX STRUCTURE IN ATP-FORM",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 15.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.71e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p02550"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.46e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "p02554"
}
]
},
{
"metadata": {
"accession": "1jff",
"name": "Refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.5
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p81947"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "1sa0",
"name": "TUBULIN-COLCHICINE: STATHMIN-LIKE DOMAIN COMPLEX",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.58
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "1sa1",
"name": "Tubulin-podophyllotoxin: stathmin-like domain complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 4.2
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "1tub",
"name": "TUBULIN ALPHA-BETA DIMER, ELECTRON DIFFRACTION",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.7
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.71e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV",
"sequence_length": 440,
"protein": "p02550"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.46e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD",
"sequence_length": 427,
"protein": "p02554"
}
]
},
{
"metadata": {
"accession": "1tvk",
"name": "The binding mode of epothilone A on a,b-tubulin by electron crystallography",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 2.89
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSV",
"sequence_length": 440,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 51,
"auth_end": 70
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 93,
"auth_end": 104
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 106,
"auth_end": 130
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 132,
"auth_end": 150
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 151,
"auth_end": 172
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 176,
"auth_end": 189
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 190,
"auth_end": 210
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 370,
"auth_end": 398
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD",
"sequence_length": 427,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "1z2b",
"name": "Tubulin-colchicine-vinblastine: stathmin-like domain complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 4.1
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE",
"sequence_length": 448,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE",
"sequence_length": 448,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "1z5v",
"name": "Crystal structure of human gamma-tubulin bound to GTPgammaS",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.71
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.32e-11
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.89e-10
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.96e-05
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.27e-07
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.22e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.06e-10
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.27e-07
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.71e-06
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.82e-08
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS",
"auth_start": 11,
"auth_end": 31
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS",
"auth_start": 52,
"auth_end": 71
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS",
"auth_start": 179,
"auth_end": 192
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS",
"auth_start": 193,
"auth_end": 213
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQVDVDGGEQKLISEEDLLLEHHHHHH",
"sequence_length": 474,
"protein": "p23258"
}
]
},
{
"metadata": {
"accession": "1z5w",
"name": "Crystal Structure of gamma-tubulin bound to GTP",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.32e-11
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.89e-10
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.96e-05
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.27e-07
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.22e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.06e-10
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.27e-07
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.71e-06
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.82e-08
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS",
"auth_start": 11,
"auth_end": 31
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS",
"auth_start": 52,
"auth_end": 71
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS",
"auth_start": 179,
"auth_end": 192
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS",
"auth_start": 193,
"auth_end": 213
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQVDVDGGEQKLISEEDLLLEHHHHHH",
"sequence_length": 474,
"protein": "p23258"
}
]
},
{
"metadata": {
"accession": "2bto",
"name": "Structure of BtubA from Prosthecobacter dejongeii",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.5
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.11e-10
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.23e-10
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.00248
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.000472
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-11
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.37e-06
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.04e-05
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.12e-06
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.01e-10
}
],
"protein_length": 473,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS",
"auth_start": 12,
"auth_end": 32
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS",
"auth_start": 56,
"auth_end": 75
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS",
"auth_start": 97,
"auth_end": 108
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS",
"auth_start": 110,
"auth_end": 134
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS",
"auth_start": 136,
"auth_end": 154
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS",
"auth_start": 155,
"auth_end": 176
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS",
"auth_start": 180,
"auth_end": 193
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS",
"auth_start": 194,
"auth_end": 214
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS",
"auth_start": 375,
"auth_end": 403
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
"sequence_length": 473,
"protein": "q8gcc5"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.11e-10
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.23e-10
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.00248
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.000472
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-11
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.37e-06
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.04e-05
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.12e-06
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.01e-10
}
],
"protein_length": 473,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS",
"auth_start": 12,
"auth_end": 32
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS",
"auth_start": 56,
"auth_end": 75
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS",
"auth_start": 97,
"auth_end": 108
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS",
"auth_start": 110,
"auth_end": 134
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS",
"auth_start": 136,
"auth_end": 154
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS",
"auth_start": 155,
"auth_end": 176
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS",
"auth_start": 194,
"auth_end": 214
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS",
"auth_start": 375,
"auth_end": 403
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
"sequence_length": 473,
"protein": "q8gcc5"
}
]
},
{
"metadata": {
"accession": "2btq",
"name": "Structure of BtubAB heterodimer from Prosthecobacter dejongeii",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.2
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.11e-10
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.23e-10
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.00248
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.000472
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-11
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.37e-06
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.04e-05
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.12e-06
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.01e-10
}
],
"protein_length": 473,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 12,
"end": 32,
"dc-status": "CONTINUOUS",
"auth_start": 12,
"auth_end": 32
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 56,
"end": 75,
"dc-status": "CONTINUOUS",
"auth_start": 56,
"auth_end": 75
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 97,
"end": 108,
"dc-status": "CONTINUOUS",
"auth_start": 97,
"auth_end": 108
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 110,
"end": 134,
"dc-status": "CONTINUOUS",
"auth_start": 110,
"auth_end": 134
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 136,
"end": 154,
"dc-status": "CONTINUOUS",
"auth_start": 136,
"auth_end": 154
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 155,
"end": 176,
"dc-status": "CONTINUOUS",
"auth_start": 155,
"auth_end": 176
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 180,
"end": 193,
"dc-status": "CONTINUOUS",
"auth_start": 180,
"auth_end": 193
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 194,
"end": 214,
"dc-status": "CONTINUOUS",
"auth_start": 194,
"auth_end": 214
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 375,
"end": 403,
"dc-status": "CONTINUOUS",
"auth_start": 375,
"auth_end": 403
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MKVNNTIVVSIGQAGNQIAASFWKTVCLEHGIDPLTGQTAPGVAPRGNWSSFFSKLGESSSGSYVPRAIMVDLEPSVIDNVKATSGSLFNPANLISRTEGAGGNFAVGYLGAGREVLPEVMSRLDYEIDKCDNVGGIIVLHAIGGGTGSGFGALLIESLKEKYGEIPVLSCAVLPSPQVSSVVTEPYNTVFALNTLRRSADACLIFDNEALFDLAHRKWNIESPTVDDLNLLITEALAGITASMRFSGFLTVEISLRELLTNLVPQPSLHFLMCAFAPLTPPDRSKFEELGIEEMIKSLFDNGSVFAACSPMEGRFLSTAVLYRGIMEDKPLADAALAAMREKLPLTYWIPTAFKIGYVEQPGISHRKSMVLLANNTEIARVLDRICHNFDKLWQRKAFANWYLNEGMSEEQINVLRASAQELVQSYQVAEESGAKAKVQDSAGDTGMRAAAAGVSDDARGSMSLRDLVDRRR",
"sequence_length": 473,
"protein": "q8gcc5"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.37e-09
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.22e-11
},
{
"fragments": [
{
"start": 94,
"end": 105,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.8e-05
},
{
"fragments": [
{
"start": 107,
"end": 131,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 0.000129
},
{
"fragments": [
{
"start": 133,
"end": 151,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.19e-13
},
{
"fragments": [
{
"start": 152,
"end": 173,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 6.29e-10
},
{
"fragments": [
{
"start": 177,
"end": 190,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.62e-07
},
{
"fragments": [
{
"start": 191,
"end": 211,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.9e-07
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.28e-11
}
],
"protein_length": 426,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS",
"auth_start": 52,
"auth_end": 71
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 94,
"end": 105,
"dc-status": "CONTINUOUS",
"auth_start": 94,
"auth_end": 105
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 107,
"end": 131,
"dc-status": "CONTINUOUS",
"auth_start": 107,
"auth_end": 131
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 133,
"end": 151,
"dc-status": "CONTINUOUS",
"auth_start": 133,
"auth_end": 151
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 152,
"end": 173,
"dc-status": "CONTINUOUS",
"auth_start": 152,
"auth_end": 173
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 177,
"end": 190,
"dc-status": "CONTINUOUS",
"auth_start": 177,
"auth_end": 190
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 191,
"end": 211,
"dc-status": "CONTINUOUS",
"auth_start": 191,
"auth_end": 211
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 370,
"auth_end": 398
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "VREILSIHVGQCGNQIADSFWRLALREHGLTEAGTLKEGSNAAANSNMEVFFHKVRDGKYVPRAVLVDLEPGVIARIEGGDMSQLFDESSIVRKIPGAANNWARGYNVEGEKVIDQIMNVIDSAVEKTKGLQGFLMTHSIGGGSGSGLGSLILERLRQAYPKKRIFTFSVVPSPLISDSAVEPYNAILTLQRILDNADGAVLLDNEALFRIAKAKLNRSPNYMDLNNIIALIVSSVTASLRFPGKLNTDLSEFVTNLVPFPGNHFLTASFAPMRGAGQEGQVRTNFPDLARETFAQDNFTAAIDWQQGVYLAASALFRGDVKAKDVDENMATIRKSLNYASYMPASGGLKLGYAETAPEGFASSGLALVNHTGIAAVFERLIAQFDIMFDNHAYTHWYENAGVSRDMMAKARNQIATLAQSYRDAS",
"sequence_length": 426,
"protein": "q8gcc1"
}
]
},
{
"metadata": {
"accession": "2hxf",
"name": "KIF1A head-microtubule complex structure in amppnp-form",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 10.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.71e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p02550"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.46e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "p02554"
}
]
},
{
"metadata": {
"accession": "2hxh",
"name": "KIF1A head-microtubule complex structure in adp-form",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 11.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.71e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p02550"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.46e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "p02554"
}
]
},
{
"metadata": {
"accession": "2p4n",
"name": "Human Monomeric Kinesin (1BG2) and Bovine Tubulin (1JFF) Docked into the 9-Angstrom Cryo-EM Map of Nucleotide-Free Kinesin Complexed to the Microtubule",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 9.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.71e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p02550"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "2wbe",
"name": "Kinesin-5-Tubulin Complex with AMPPNP",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 9.4
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "2xrp",
"name": "Human Doublecortin N-DC Repeat (1MJD) and Mammalian Tubulin (1JFF and 3HKE) Docked into the 8-Angstrom Cryo-EM Map of Doublecortin- Stabilised Microtubules",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 8.2
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
"sequence_length": 452,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
"sequence_length": 452,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "E",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "F",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
"sequence_length": 452,
"protein": "q2hj86"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "G",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.31e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.15e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.95e-13
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.51e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 452,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "H",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEEGEEY",
"sequence_length": 452,
"protein": "q2hj86"
}
]
},
{
"metadata": {
"accession": "3cb2",
"name": "Crystal structure of human gamma-tubulin bound to GDP",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.303
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.32e-11
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.89e-10
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.96e-05
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.27e-07
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.22e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.06e-10
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.27e-07
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.71e-06
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.82e-08
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS",
"auth_start": 11,
"auth_end": 31
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS",
"auth_start": 52,
"auth_end": 71
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS",
"auth_start": 96,
"auth_end": 107
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS",
"auth_start": 179,
"auth_end": 192
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS",
"auth_start": 193,
"auth_end": 213
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQVDVDGGQKLISEEDLLLEHHHHHH",
"sequence_length": 475,
"protein": "p23258"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.32e-11
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.89e-10
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.96e-05
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.27e-07
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 3.22e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.06e-10
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.27e-07
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 4.71e-06
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.82e-08
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 11,
"end": 31,
"dc-status": "CONTINUOUS",
"auth_start": 11,
"auth_end": 31
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 52,
"end": 71,
"dc-status": "CONTINUOUS",
"auth_start": 52,
"auth_end": 71
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 96,
"end": 107,
"dc-status": "CONTINUOUS",
"auth_start": 96,
"auth_end": 107
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 179,
"end": 192,
"dc-status": "CONTINUOUS",
"auth_start": 179,
"auth_end": 192
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 193,
"end": 213,
"dc-status": "CONTINUOUS",
"auth_start": 193,
"auth_end": 213
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEAIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCLVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQVDVDGGQKLISEEDLLLEHHHHHH",
"sequence_length": 475,
"protein": "p23258"
}
]
},
{
"metadata": {
"accession": "3dco",
"name": "Drosophila NOD (3DC4) and Bovine Tubulin (1JFF) Docked into the 11-Angstrom Cryo-EM Map of Nucleotide-Free NOD Complexed to the Microtubule",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 11.0
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.29e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.37e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.49e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.92e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.22e-15
}
],
"protein_length": 451,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY",
"sequence_length": 451,
"protein": "p81947"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
},
{
"metadata": {
"accession": "3du7",
"name": "Tubulin-colchicine-phomopsin A: Stathmin-like domain complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 4.1
},
"entries": [
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.26e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.25e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.46e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.9e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-15
}
],
"protein_length": 449,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDLVLDRVRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMSQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSYEDEDEGEEY",
"sequence_length": 449,
"protein": "q3zcj7"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.34e-11
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 8.26e-13
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-06
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.25e-13
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.04e-12
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.46e-11
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.54e-07
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.9e-11
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.55e-15
}
],
"protein_length": 449,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 53,
"end": 72,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 95,
"end": 106,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 108,
"end": 132,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 134,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 153,
"end": 174,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 178,
"end": 191,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 192,
"end": 212,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 380,
"end": 408,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDLVLDRVRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLMSQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSYEDEDEGEEY",
"sequence_length": 449,
"protein": "q3zcj7"
},
{
"accession": "PR01161",
"entry_protein_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.46e-12
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1.11e-12
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 2.97e-08
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.77e-16
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.11e-15
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 5.19e-13
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 9.81e-09
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 7.15e-13
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": "PR01161",
"score": 1e-16
}
],
"protein_length": 445,
"source_database": "prints",
"entry_type": "family",
"entry_integrated": "ipr000217",
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 10,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 10,
"auth_end": 30
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 51,
"end": 70,
"dc-status": "CONTINUOUS",
"auth_start": 53,
"auth_end": 72
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 93,
"end": 104,
"dc-status": "CONTINUOUS",
"auth_start": 95,
"auth_end": 106
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 106,
"end": 130,
"dc-status": "CONTINUOUS",
"auth_start": 108,
"auth_end": 132
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 132,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 134,
"auth_end": 152
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 151,
"end": 172,
"dc-status": "CONTINUOUS",
"auth_start": 153,
"auth_end": 174
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 176,
"end": 189,
"dc-status": "CONTINUOUS",
"auth_start": 178,
"auth_end": 191
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 190,
"end": 210,
"dc-status": "CONTINUOUS",
"auth_start": 192,
"auth_end": 212
}
],
"representative": false,
"model": "PR01161",
"score": null
},
{
"fragments": [
{
"start": 370,
"end": 398,
"dc-status": "CONTINUOUS",
"auth_start": 380,
"auth_end": 408
}
],
"representative": false,
"model": "PR01161",
"score": null
}
],
"sequence": "MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA",
"sequence_length": 445,
"protein": "q6b856"
}
]
}
]
}