HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"count": 32,
"next": "https://www.ebi.ac.uk/interpro/wwwapi/structure/PDB/entry/InterPro/IPR000905/?cursor=source%3As%3A4ydu&page_size=20",
"previous": null,
"results": [
{
"metadata": {
"accession": "1okj",
"name": "crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex \"DOTMA\"",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.28
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 17,
"end": 153,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
"sequence_length": 251,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 17,
"end": 153,
"dc-status": "CONTINUOUS",
"auth_start": -4,
"auth_end": 132
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
"sequence_length": 251,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 17,
"end": 153,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
"sequence_length": 251,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 17,
"end": 153,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
"sequence_length": 251,
"protein": "p76256"
}
]
},
{
"metadata": {
"accession": "2a6a",
"name": "Crystal structure of Glycoprotein endopeptidase (tm0874) from THERMOTOGA MARITIMA at 2.50 A resolution",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.5
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 30,
"end": 144,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 206,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 42,
"end": 155,
"dc-status": "CONTINUOUS",
"auth_start": 30,
"auth_end": 143
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MGSDKIHHHHHHMNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQKSIAELNWEKKKRG",
"sequence_length": 218,
"protein": "q9wzx7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 30,
"end": 144,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 206,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 42,
"end": 155,
"dc-status": "CONTINUOUS",
"auth_start": 30,
"auth_end": 143
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MGSDKIHHHHHHMNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQKSIAELNWEKKKRG",
"sequence_length": 218,
"protein": "q9wzx7"
}
]
},
{
"metadata": {
"accession": "2gel",
"name": "2.05A crystal structure of Salmonella typhimurium YeaZ, form B",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.05
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "q7cqe0"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "G",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "q7cqe0"
}
]
},
{
"metadata": {
"accession": "2gem",
"name": "2.1A crystal structure of Salmonella tyhpimurium YeaZ, a putative Gram-negative RPF, form-A",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.1
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "q7cqe0"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "q7cqe0"
}
]
},
{
"metadata": {
"accession": "2ivn",
"name": "Structure of UP1 protein",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 1.65
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
}
]
},
{
"metadata": {
"accession": "2ivo",
"name": "Structure of UP1 protein",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.9
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
}
]
},
{
"metadata": {
"accession": "2ivp",
"name": "Structure of UP1 protein",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.5
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 324,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
"sequence_length": 330,
"protein": "q9uxt7"
}
]
},
{
"metadata": {
"accession": "2vwb",
"name": "Structure of the archaeal Kae1-Bud32 fusion protein MJ1130: a model for the eukaryotic EKC-KEOPS subcomplex involved in transcription and telomere homeostasis.",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.05
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 323
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 535,
"protein": "q58530"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 323
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 535,
"protein": "q58530"
}
]
},
{
"metadata": {
"accession": "3en9",
"name": "Structure of the Methanococcus jannaschii KAE1-BUD32 fusion protein",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.67
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 328,
"dc-status": "CONTINUOUS",
"auth_start": -1,
"auth_end": 323
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 540,
"protein": "q58530"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 328,
"dc-status": "CONTINUOUS",
"auth_start": -1,
"auth_end": 323
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 540,
"protein": "q58530"
}
]
},
{
"metadata": {
"accession": "3enh",
"name": "Crystal structure of Cgi121/Bud32/Kae1 complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.6
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 328,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 540,
"protein": "q58530"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 323,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 535,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 328,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
"sequence_length": 540,
"protein": "q58530"
}
]
},
{
"metadata": {
"accession": "3eno",
"name": "Crystal structure of Pyrococcus furiosus Pcc1 in complex with Thermoplasma acidophilum Kae1",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.0201
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 529,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 329,
"dc-status": "CONTINUOUS",
"auth_start": -1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMIVLGLEGTAHTISCGIIDESRILAMESSMYRPKTGGIRPLDAAVHHSEVIDTVISRALEKAKISIHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIGRRVTGAIDPVMLYVSGGNTQVIAHVNGRYRVLGETLDIGIGNMIDKFAREAGIPFPGGPEIEKLAMKGTKLLDLPYSVKGMDTAFSGILTAALQYLKTGQAIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREAGIRSYLTDREYCMDNGIMIAQAALLMYKSGVRMSVEETAVNPRFRIDEVDAPWITDAS",
"sequence_length": 334,
"protein": "q9hla5"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 324,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 529,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 4,
"end": 329,
"dc-status": "CONTINUOUS",
"auth_start": -1,
"auth_end": 324
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPMIVLGLEGTAHTISCGIIDESRILAMESSMYRPKTGGIRPLDAAVHHSEVIDTVISRALEKAKISIHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIGRRVTGAIDPVMLYVSGGNTQVIAHVNGRYRVLGETLDIGIGNMIDKFAREAGIPFPGGPEIEKLAMKGTKLLDLPYSVKGMDTAFSGILTAALQYLKTGQAIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREAGIRSYLTDREYCMDNGIMIAQAALLMYKSGVRMSVEETAVNPRFRIDEVDAPWITDAS",
"sequence_length": 334,
"protein": "q9hla5"
}
]
},
{
"metadata": {
"accession": "3r6m",
"name": "Crystal structure of Vibrio parahaemolyticus YeaZ",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 3.1
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 227,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 233,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 3,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 3,
"auth_end": 152
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
"sequence_length": 213,
"protein": "q87rd1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 227,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 233,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 3,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 3,
"auth_end": 152
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
"sequence_length": 213,
"protein": "q87rd1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 227,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 233,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 3,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 3,
"auth_end": 152
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
"sequence_length": 213,
"protein": "q87rd1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 227,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 233,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 3,
"end": 152,
"dc-status": "CONTINUOUS",
"auth_start": 3,
"auth_end": 152
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
"sequence_length": 213,
"protein": "q87rd1"
}
]
},
{
"metadata": {
"accession": "3wuh",
"name": "Qri7 and AMP complex",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.937
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 30,
"end": 397,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 407,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 373,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GPLHMRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
"sequence_length": 383,
"protein": "p43122"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 30,
"end": 397,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 407,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 373,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GPLHMRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
"sequence_length": 383,
"protein": "p43122"
}
]
},
{
"metadata": {
"accession": "3zet",
"name": "Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer.",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.31
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG",
"sequence_length": 229,
"protein": "e8x8j1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
"sequence_length": 337,
"protein": "e8xbd7"
}
]
},
{
"metadata": {
"accession": "3zeu",
"name": "Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer bound to ATPgammaS",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 1.653
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "e8x8j1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
"sequence_length": 337,
"protein": "p40731"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 150,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 150
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
"sequence_length": 231,
"protein": "e8x8j1"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "E",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
"sequence_length": 337,
"protein": "p40731"
}
]
},
{
"metadata": {
"accession": "4k25",
"name": "Crystal Structure of yeast Qri7 homodimer",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.88
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 30,
"end": 397,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 407,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 373,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "GAMDPRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
"sequence_length": 383,
"protein": "p43122"
}
]
},
{
"metadata": {
"accession": "4wq4",
"name": "E. coli YgjD(E12A)-YeaZ heterodimer in complex with ATP",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.33
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
}
]
},
{
"metadata": {
"accession": "4wq5",
"name": "YgjD(V85E)-YeaZ heterodimer in complex with ATP",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.33
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLEGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLEGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
}
]
},
{
"metadata": {
"accession": "4y0w",
"name": "YeaZ from Pseudomonas aeruginosa",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.5
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 153,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 226,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 158,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
"sequence_length": 232,
"protein": "a0a140uha7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 153,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 226,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 158,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
"sequence_length": 232,
"protein": "a0a140uha7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 153,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 226,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 158,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
"sequence_length": 232,
"protein": "a0a140uha7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 153,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 226,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 158,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
"sequence_length": 232,
"protein": "a0a140uha7"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 3,
"end": 153,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 226,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "E",
"entry_structure_locations": [
{
"fragments": [
{
"start": 6,
"end": 158,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
"sequence_length": 232,
"protein": "a0a140uha7"
}
]
},
{
"metadata": {
"accession": "4ydu",
"name": "Crystal structure of E. coli YgjD-YeaZ heterodimer in complex with ADP",
"source_database": "pdb",
"experiment_type": "x-ray",
"resolution": 2.33
},
"entries": [
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "A",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 337,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "B",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 334,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 334
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
"sequence_length": 343,
"protein": "p05852"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "C",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
},
{
"accession": "IPR000905",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 231,
"source_database": "interpro",
"entry_type": "domain",
"entry_integrated": null,
"chain": "D",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 133,
"dc-status": "CONTINUOUS",
"auth_start": 1,
"auth_end": 133
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
"sequence_length": 237,
"protein": "p76256"
}
]
}
]
}