GET /api/structure/PDB/entry/InterPro/IPR000905
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "count": 32,
    "next": "https://www.ebi.ac.uk/interpro/wwwapi/structure/PDB/entry/InterPro/IPR000905/?cursor=source%3As%3A4ydu&page_size=20",
    "previous": null,
    "results": [
        {
            "metadata": {
                "accession": "1okj",
                "name": "crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex \"DOTMA\"",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.28
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 17,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
                    "sequence_length": 251,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 17,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": -4,
                                    "auth_end": 132
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
                    "sequence_length": 251,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 17,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
                    "sequence_length": 251,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 17,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SYYHHHHHHLESTSLYKKAGLRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKE",
                    "sequence_length": 251,
                    "protein": "p76256"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2a6a",
                "name": "Crystal structure of Glycoprotein endopeptidase (tm0874) from THERMOTOGA MARITIMA at 2.50 A resolution",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.5
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 30,
                                    "end": 144,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 206,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 42,
                                    "end": 155,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 30,
                                    "auth_end": 143
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MGSDKIHHHHHHMNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQKSIAELNWEKKKRG",
                    "sequence_length": 218,
                    "protein": "q9wzx7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 30,
                                    "end": 144,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 206,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 42,
                                    "end": 155,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 30,
                                    "auth_end": 143
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MGSDKIHHHHHHMNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQKSIAELNWEKKKRG",
                    "sequence_length": 218,
                    "protein": "q9wzx7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2gel",
                "name": "2.05A crystal structure of Salmonella typhimurium YeaZ, form B",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.05
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "q7cqe0"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "G",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "q7cqe0"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2gem",
                "name": "2.1A crystal structure of Salmonella tyhpimurium YeaZ, a putative Gram-negative RPF, form-A",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.1
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "q7cqe0"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "q7cqe0"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2ivn",
                "name": "Structure of UP1 protein",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 1.65
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2ivo",
                "name": "Structure of UP1 protein",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.9
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2ivp",
                "name": "Structure of UP1 protein",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.5
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 324,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MLALGIEGTAHTLGIGIVSEDKVLANVFDTLTTEKGGIHPKEAAEHHARLMKPLLRKALSEAGVSLDDIDVIAFSQGPGLGPALRVVATAARALAVKYRKPIVGVNHCIAHVEITKMFGVKDPVGLYVSGGNTQVLALEGGRYRVFGETLDIGIGNAIDVFARELGLGFPGGPKVEKLAEKGEKYIELPYAVKGMDLSFSGLLTEAIRKYRSGKYRVEDLAYSFQETAFAALVEVTERAVAHTEKDEVVLVGGVAANNRLREMLRIMTEDRGIKFFVPPYDLCRDNGAMIAYTGLRMYKAGISFRLEETIVKQKFRTDEVEIVWHHHHHH",
                    "sequence_length": 330,
                    "protein": "q9uxt7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "2vwb",
                "name": "Structure of the archaeal Kae1-Bud32 fusion protein MJ1130: a model for the eukaryotic EKC-KEOPS subcomplex involved in transcription and telomere homeostasis.",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.05
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 323
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 535,
                    "protein": "q58530"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 323
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 535,
                    "protein": "q58530"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3en9",
                "name": "Structure of the Methanococcus jannaschii KAE1-BUD32 fusion protein",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.67
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 328,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": -1,
                                    "auth_end": 323
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 540,
                    "protein": "q58530"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 328,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": -1,
                                    "auth_end": 323
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 540,
                    "protein": "q58530"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3enh",
                "name": "Crystal structure of Cgi121/Bud32/Kae1 complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.6
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 328,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 540,
                    "protein": "q58530"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 323,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 535,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 328,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMICLGLEGTAEKTGVGIVTSDGEVLFNKTIMYKPPKQGINPREAADHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLSLTLKKPIIGVNHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKKYRVFGETLDIAVGNCLDQFARYVNLPHPGGPYIEELARKGKKLVDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYSLQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCEGQNVDFYVPPKEFCGDNGAMIAWLGLLMHKNGRWMSLDETKIIPNYRTDMVEVNWIKEIKGKKRKIPEHLIGKGAEADIKRDSYLDFDVIIKERVKKGYRDERLDENIRKSRTAREARYLALVKDFGIPAPYIFDVDLDNKRIMMSYINGKLAKDVIEDNLDIAYKIGEIVGKLHKNDVIHNDLTTSNFIFDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHHEKFDEIWERFLEGYKSVYDRWEIILELMKDVERRARYVE",
                    "sequence_length": 540,
                    "protein": "q58530"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3eno",
                "name": "Crystal structure of Pyrococcus furiosus Pcc1 in complex with Thermoplasma acidophilum Kae1",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.0201
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 529,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 329,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": -1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMIVLGLEGTAHTISCGIIDESRILAMESSMYRPKTGGIRPLDAAVHHSEVIDTVISRALEKAKISIHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIGRRVTGAIDPVMLYVSGGNTQVIAHVNGRYRVLGETLDIGIGNMIDKFAREAGIPFPGGPEIEKLAMKGTKLLDLPYSVKGMDTAFSGILTAALQYLKTGQAIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREAGIRSYLTDREYCMDNGIMIAQAALLMYKSGVRMSVEETAVNPRFRIDEVDAPWITDAS",
                    "sequence_length": 334,
                    "protein": "q9hla5"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 324,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 529,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 4,
                                    "end": 329,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": -1,
                                    "auth_end": 324
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPMIVLGLEGTAHTISCGIIDESRILAMESSMYRPKTGGIRPLDAAVHHSEVIDTVISRALEKAKISIHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIGRRVTGAIDPVMLYVSGGNTQVIAHVNGRYRVLGETLDIGIGNMIDKFAREAGIPFPGGPEIEKLAMKGTKLLDLPYSVKGMDTAFSGILTAALQYLKTGQAIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREAGIRSYLTDREYCMDNGIMIAQAALLMYKSGVRMSVEETAVNPRFRIDEVDAPWITDAS",
                    "sequence_length": 334,
                    "protein": "q9hla5"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3r6m",
                "name": "Crystal structure of Vibrio parahaemolyticus YeaZ",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.1
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 227,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 233,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 3,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
                    "sequence_length": 213,
                    "protein": "q87rd1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 227,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 233,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 3,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
                    "sequence_length": 213,
                    "protein": "q87rd1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 227,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 233,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 3,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
                    "sequence_length": 213,
                    "protein": "q87rd1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 227,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 233,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 152,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 3,
                                    "auth_end": 152
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "SAKILAIDTATENCSVALLVNDQVISRSEVAPRDHTKKVLPMVDEVLKEAGLTLQDLDALAFGRGPGSFTGVRIGIGIAQGLAFGAELPMIGVSTLAAMAQASYRLHGATDVAVAIDARMSEVYWARYSRQENGEWIGVDEECVIPPARLAEEAQADSKTWTTAGTGWSAYQEELAGLPFNTADSEVLYPDSQDIVILAKQELEKGNTVPVEE",
                    "sequence_length": 213,
                    "protein": "q87rd1"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3wuh",
                "name": "Qri7 and AMP complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.937
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 30,
                                    "end": 397,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 407,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 373,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GPLHMRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
                    "sequence_length": 383,
                    "protein": "p43122"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 30,
                                    "end": 397,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 407,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 373,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GPLHMRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
                    "sequence_length": 383,
                    "protein": "p43122"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3zet",
                "name": "Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer.",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.31
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPG",
                    "sequence_length": 229,
                    "protein": "e8x8j1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
                    "sequence_length": 337,
                    "protein": "e8xbd7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "3zeu",
                "name": "Structure of a Salmonella typhimurium YgjD-YeaZ heterodimer bound to ATPgammaS",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 1.653
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "e8x8j1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
                    "sequence_length": 337,
                    "protein": "p40731"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 150,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 150
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGKE",
                    "sequence_length": 231,
                    "protein": "e8x8j1"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "E",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAFAWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIKCKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA",
                    "sequence_length": 337,
                    "protein": "p40731"
                }
            ]
        },
        {
            "metadata": {
                "accession": "4k25",
                "name": "Crystal Structure of yeast Qri7 homodimer",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.88
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 30,
                                    "end": 397,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 407,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 373,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "GAMDPRKGYKVLAIETSCDDTCVSVLDRFSKSAAPNVLANLKDTLDSIDEGGIIPTKAHIHHQARIGPLTERALIESNAREGIDLICVTRGPGMPGSLSGGLDFAKGLAVAWNKPLIGVHHMLGHLLIPRMGTNGKVPQFPFVSLLVSGGHTTFVLSRAIDDHEILCDTIDIAVGDSLDKCGRELGFKGTMIAREMEKFINQDINDQDFALKLEMPSPLKNSASKRNMLSFSFSAFITALRTNLTKLGKTEIQELPEREIRSIAYQVQESVFDHIINKLKHVLKSQPEKFKNVREFVCSGGVSSNQRLRTKLETELGTLNSTSFFNFYYPPMDLCSDNSIMIGWAGIEIWESLRLVSDLDICPIRQWPLNDLLSVDGWRTDQL",
                    "sequence_length": 383,
                    "protein": "p43122"
                }
            ]
        },
        {
            "metadata": {
                "accession": "4wq4",
                "name": "E. coli YgjD(E12A)-YeaZ heterodimer in complex with ATP",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.33
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDATGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                }
            ]
        },
        {
            "metadata": {
                "accession": "4wq5",
                "name": "YgjD(V85E)-YeaZ heterodimer in complex with ATP",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.33
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLEGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLEGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                }
            ]
        },
        {
            "metadata": {
                "accession": "4y0w",
                "name": "YeaZ from Pseudomonas aeruginosa",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.5
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 226,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 158,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
                    "sequence_length": 232,
                    "protein": "a0a140uha7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 226,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 158,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
                    "sequence_length": 232,
                    "protein": "a0a140uha7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 226,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 158,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
                    "sequence_length": 232,
                    "protein": "a0a140uha7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 226,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 158,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
                    "sequence_length": 232,
                    "protein": "a0a140uha7"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 3,
                                    "end": 153,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 226,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "E",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 6,
                                    "end": 158,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "HHHHHHMSTLLALDTSTEACSVALLHEGRALSHYEVIPRLHAQRLLPMVRDLLDEAGVALSAVDAIAFGRGPGAFTGVRIAIGVVQGLAFALQRPVLAVSDLAILAQRAYREQGAERVAAAIDARMDEVYWGCYQLQQGEMRLAGSEAVLPPERVAVPWDAAAADWFGAGTGWGYVERMPQRPVALDASLLPHAEDLLSLAGFAWARGEGVEAEQALPVYLRDNVATPKKAP",
                    "sequence_length": 232,
                    "protein": "a0a140uha7"
                }
            ]
        },
        {
            "metadata": {
                "accession": "4ydu",
                "name": "Crystal structure of E. coli YgjD-YeaZ heterodimer in complex with ADP",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.33
            },
            "entries": [
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 337,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 334,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 334
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPAAHHHHHH",
                    "sequence_length": 343,
                    "protein": "p05852"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                },
                {
                    "accession": "IPR000905",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "protein_length": 231,
                    "source_database": "interpro",
                    "entry_type": "domain",
                    "entry_integrated": null,
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 1,
                                    "end": 133,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 1,
                                    "auth_end": 133
                                }
                            ],
                            "representative": false,
                            "model": null,
                            "score": null
                        }
                    ],
                    "sequence": "MRILAIDTATEACSVALWNDGTVNAHFELCPREHTQRILPMVQDILTTSGTSLTDINALAYGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLMTMAQGAWRKNGATRVLAAIDARMGEVYWAEYQRDENGIWHGEETEAVLKPEIVHERMQQLSGEWVTVGTGWQAWPDLGKESGLVLRDGEVLLPAAEDMLPIACQMFAEGKTVAVEHAEPVYLRNNVAWKKLPGKEHHHHHH",
                    "sequence_length": 237,
                    "protein": "p76256"
                }
            ]
        }
    ]
}