HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"count": 35,
"next": "https://www.ebi.ac.uk/interpro/wwwapi/structure/PDB/entry/InterPro/IPR001421/?cursor=source%3As%3A7aje&page_size=20",
"previous": null,
"results": [
{
"metadata": {
"accession": "6j54",
"name": "Cryo-EM structure of the mammalian E-state ATP synthase FO section",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.94
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 5,
"auth_end": 34
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "DTSTWFITITSMIMTLFILFQLKISNYSYP",
"sequence_length": 30,
"protein": null
}
]
},
{
"metadata": {
"accession": "6j5a",
"name": "Cryo-EM structure of the mammalian DP-state ATP synthase FO section",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 4.35
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 30,
"dc-status": "CONTINUOUS",
"auth_start": 5,
"auth_end": 34
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "DTSTWFITITSMIMTLFILFQLKISNYSYP",
"sequence_length": 30,
"protein": null
}
]
},
{
"metadata": {
"accession": "6j5i",
"name": "Cryo-EM structure of the mammalian DP-state ATP synthase",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.34
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
}
]
},
{
"metadata": {
"accession": "6j5j",
"name": "Cryo-EM structure of the mammalian E-state ATP synthase",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.45
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
}
]
},
{
"metadata": {
"accession": "6j5k",
"name": "Cryo-EM structure of the mammalian ATP synthase tetramer bound with inhibitory protein IF1",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 6.2
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
},
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
},
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "B8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
},
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "C8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": null
}
]
},
{
"metadata": {
"accession": "6tt7",
"name": "Ovine ATP synthase 1a state",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.5
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "Q",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL",
"sequence_length": 66,
"protein": null
}
]
},
{
"metadata": {
"accession": "6za9",
"name": "Fo domain of Ovine ATP synthase",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.76
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [],
"protein_length": null,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "Q",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYHNPELMTTKTPKQNTPWETKWTKIYLPLSLPL",
"sequence_length": 66,
"protein": null
}
]
},
{
"metadata": {
"accession": "6zbb",
"name": "bovine ATP synthase Fo domain",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.61
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6ziq",
"name": "bovine ATP synthase stator domain, state 1",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 4.33
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6zit",
"name": "bovine ATP synthase Stator domain, state 2",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.49
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6ziu",
"name": "bovine ATP synthase stator domain, state 3",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 6.02
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6zmr",
"name": "Porcine ATP synthase Fo domain",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.94
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 67,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": "q35914"
}
]
},
{
"metadata": {
"accession": "6zna",
"name": "Porcine ATP synthase Fo domain",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 6.2
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 67,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": "q35914"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 67,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": "q35914"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 67,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "B8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": "q35914"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 67,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "C8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWFITITSMIMTLFILFQLKISNYSYPASPESIELKTQKHSTPWEMKWTKIYLPLLLPPR",
"sequence_length": 67,
"protein": "q35914"
}
]
},
{
"metadata": {
"accession": "6zpo",
"name": "bovine ATP synthase monomer state 1 (combined)",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 4.0
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6zqm",
"name": "bovine ATP synthase monomer state 2 (combined)",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 3.29
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "6zqn",
"name": "bovine ATP synthase monomer state 3 (combined)",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 4.0
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "7ajb",
"name": "bovine ATP synthase dimer state1:state1",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 9.2
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "7ajc",
"name": "bovine ATP synthase dimer state1:state2",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 11.9
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "7ajd",
"name": "bovine ATP synthase dimer state1:state3",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 9.0
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
},
{
"metadata": {
"accession": "7aje",
"name": "bovine ATP synthase dimer state2:state1",
"source_database": "pdb",
"experiment_type": "em",
"resolution": 9.4
},
"entries": [
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
},
{
"accession": "IPR001421",
"entry_protein_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS"
}
],
"representative": false,
"model": null,
"score": null
}
],
"protein_length": 66,
"source_database": "interpro",
"entry_type": "family",
"entry_integrated": null,
"chain": "A8",
"entry_structure_locations": [
{
"fragments": [
{
"start": 1,
"end": 55,
"dc-status": "CONTINUOUS",
"auth_start": null,
"auth_end": null
}
],
"representative": false,
"model": null,
"score": null
}
],
"sequence": "MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYLPLLLPL",
"sequence_length": 66,
"protein": "p03929"
}
]
}
]
}