GET /api/structure/PDB/entry/pfam/PF13408
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 104.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "count": 3,
    "next": null,
    "previous": null,
    "results": [
        {
            "metadata": {
                "accession": "4kis",
                "name": "Crystal Structure of a LSR-DNA Complex",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 3.2
            },
            "entries": [
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 267,
                                    "auth_end": 333
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 267,
                                    "auth_end": 333
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 267,
                                    "auth_end": 333
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 267,
                                    "auth_end": 333
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                }
            ]
        },
        {
            "metadata": {
                "accession": "5udo",
                "name": "Crystal structure of the coiled-coil domain from Listeria Innocua Phage Integrase (Tetragonal Form II)",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.541
            },
            "entries": [
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "B",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "C",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "D",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "E",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "F",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "G",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                },
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "H",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 135,
                                    "end": 201,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": null,
                                    "auth_end": null
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH",
                    "sequence_length": 328,
                    "protein": "q928v6"
                }
            ]
        },
        {
            "metadata": {
                "accession": "6dnw",
                "name": "Sequence Requirements of the Listeria innocua prophage attP site",
                "source_database": "pdb",
                "experiment_type": "x-ray",
                "resolution": 2.849
            },
            "entries": [
                {
                    "accession": "PF13408",
                    "entry_protein_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 267,
                                    "end": 333,
                                    "dc-status": "CONTINUOUS"
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": 1.1e-08
                        }
                    ],
                    "protein_length": 452,
                    "source_database": "pfam",
                    "entry_type": "domain",
                    "entry_integrated": "ipr025827",
                    "chain": "A",
                    "entry_structure_locations": [
                        {
                            "fragments": [
                                {
                                    "start": 134,
                                    "end": 200,
                                    "dc-status": "CONTINUOUS",
                                    "auth_start": 267,
                                    "auth_end": 333
                                }
                            ],
                            "representative": true,
                            "model": "PF13408",
                            "score": null
                        }
                    ],
                    "sequence": "DRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYDIFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVKGIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFVHRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRVNNYSFASRNIDKEDELDSLNEKLKIEHAKKKRLFDLYINGSYEVSELDSMMNDIDAQINYYEAQIEANEELKKNKKIQENLADLATVDFNSLEFREKQLYLKSLINKIYIDGEQVTIEWL",
                    "sequence_length": 319,
                    "protein": "q928v6"
                }
            ]
        }
    ]
}