PDBe-KB: UniProt Coverage View:
P04179
![Superoxide dismutase [Mn], mitochondrial in PDB entry 1ap6, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/1ap6_entity_1_front_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>1ap6</span> contains 4 copies of <span class='highlight'>Superoxide dismutase [Mn], mitochondrial</span>. Front view.")
![Superoxide dismutase [Mn], mitochondrial in PDB entry 1ap6, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/1ap6_entity_1_side_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>1ap6</span> contains 4 copies of <span class='highlight'>Superoxide dismutase [Mn], mitochondrial</span>. Side view.")
![Superoxide dismutase [Mn], mitochondrial in PDB entry 1ap6, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/1ap6_entity_1_top_image-200x200.png "Homo tetrameric assembly 1 of PDB entry <span class='highlight'>1ap6</span> contains 4 copies of <span class='highlight'>Superoxide dismutase [Mn], mitochondrial</span>. Top view.")
Chains: A, B
Length: 198 amino acids
Theoretical weight: 22.22 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
FASTA Sequence
Length: 198 amino acids
Theoretical weight: 22.22 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
- Canonical: P04179 (Residues: 25-222; Coverage: 89%)
FASTA Sequence
>pdb|1ap6|A B
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
PDBe-KB: UniProt Coverage View:
P04179