› › Structure analysis

Solution Structure of the Tenebrio molitor Antifreeze Protein

Solution NMR
PDB entry 1l1i coloured by chain, ensemble of 20 models, front view.
PDB entry 1l1i coloured by chain, ensemble of 20 models, side view.
PDB entry 1l1i coloured by chain, ensemble of 20 models, top view.
Source organism: Tenebrio molitor
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Thermal hysteresis protein YL-1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4608.54 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-127561

Macromolecules

Thermal hysteresis protein YL-1
Chain: A
Length: 84 amino acids
Theoretical weight: 8.39 KDa
Source organism: Tenebrio molitor
Expression system: Escherichia coli
UniProt:
  • Canonical: O16119 (Residues: 29-112; Coverage: 100%)
Pfam: Insect antifreeze protein repeat
InterPro:
CATH: Insect antifreeze protein
SCOP: Insect cysteine-rich antifreeze protein
Thermal hysteresis protein YL-1 in PDB entry 1l1i, assembly 1, front view.
Thermal hysteresis protein YL-1 in PDB entry 1l1i, assembly 1, side view.
Thermal hysteresis protein YL-1 in PDB entry 1l1i, assembly 1, top view.
PDBe-KB: UniProt Coverage View: O16119  
1841020304050607080
 
20406080QCTGGADCTSCTGACTGCGNCPNAVTCTNSQHCVKANTCTGSTDCNTAQTCTNSKDCFEANTCTDSTNCYKATACTNSSGCPGH
UniProt
O16119
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Quick links