Gap junction alpha-1 protein in PDB entry 1r5s ‹ PDBe

Chain: A
Length: 132 amino acids
Theoretical weight: 14.22 KDa
Source organism: Rattus norvegicus
Expression system: Escherichia coli
UniProt:

Canonical: P08050 (Residues: 255-382; Coverage: 34%)

Gene names: Cxn-43, Gja1
FASTA Sequence


    >pdb|1r5s|A

GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

1r5s:A

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.