› › Structure analysis

Solution structures of the SH3 domain of human rho guanine exchange factor (GEF) 16

Solution NMR
PDB entry 1x6b coloured by chain, ensemble of 20 models, front view.
PDB entry 1x6b coloured by chain, ensemble of 20 models, side view.
PDB entry 1x6b coloured by chain, ensemble of 20 models, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Rho guanine nucleotide exchange factor 16
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 5929.18 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-178436

Macromolecules

Rho guanine nucleotide exchange factor 16
Chain: A
Length: 79 amino acids
Theoretical weight: 8.57 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: Q5VV41 (Residues: 622-687; Coverage: 9%)
Gene names: ARHGEF16, EPHEXIN4, NBR
Pfam: SH3 domain
InterPro:
CATH: SH3 Domains
Rho guanine nucleotide exchange factor 16 in PDB entry 1x6b, assembly 1, front view.
Rho guanine nucleotide exchange factor 16 in PDB entry 1x6b, assembly 1, side view.
Rho guanine nucleotide exchange factor 16 in PDB entry 1x6b, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q5VV41  
17910203040506070
 
20406080GSSGSSGWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFISGPSSG
UniProt
Q5VV41
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Quick links