› › Structure analysis

Structure Basis of Venom Citrate-Dependent Heparin Sulfate-Mediated Cell Surface Retention of Cobra Cardiotoxin A3

X-ray diffraction
2.4Å resolution
PDB entry 1xt3 coloured by chain, front view.
PDB entry 1xt3 coloured by chain, side view.
PDB entry 1xt3 coloured by chain, top view.
Source organism: Naja atra
Assembly composition:
homo dimer (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Cytotoxin 3
hide full assembly name
Multimeric state: homo dimer
Accessible surface area: 8089.61 Å2
Buried surface area: 2795.49 Å2
Dissociation area: 700.48 Å2
Dissociation energy (ΔGdiss): -4.88 kcal/mol
Dissociation entropy (TΔSdiss): 10.34 kcal/mol
Symmetry number: 2
PDBe Complex ID: PDB-CPX-157993
Homo dimeric assembly 1 of PDB entry 1xt3 coloured by chemically distinct molecules, front view.
Homo dimeric assembly 1 of PDB entry 1xt3 coloured by chemically distinct molecules, side view.
Homo dimeric assembly 1 of PDB entry 1xt3 coloured by chemically distinct molecules, top view.
    Assembly 1
Confidence : 96%
No. subunits : 2
Symmetry : C2
More details
3DComplex & QSbio predictionx
No. subunits : 2
Symmetry : C2
Evidence : This biological assembly agrees with the prediction of both PISA & EPPIC

Macromolecules

Cytotoxin 3
Chains: A, B
Length: 60 amino acids
Theoretical weight: 6.76 KDa
Source organism: Naja atra
UniProt:
  • Canonical: P60301 (Residues: 22-81; Coverage: 100%)
Pfam: Snake toxin cobra-type
InterPro:
CATH: CD59
SCOP: Snake venom toxins
Cytotoxin 3 in PDB entry 1xt3, assembly 1, front view.
Cytotoxin 3 in PDB entry 1xt3, assembly 1, side view.
Cytotoxin 3 in PDB entry 1xt3, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60301  
16051015202530354045505560
 
204060LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
UniProt
P60301
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Quick links