› › Structure analysis

Solution structure of the apo form of the sixth soluble domain of Menkes protein

Solution NMR
PDB entry 1yju coloured by chain, ensemble of 30 models, front view.
PDB entry 1yju coloured by chain, ensemble of 30 models, side view.
PDB entry 1yju coloured by chain, ensemble of 30 models, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Copper-transporting ATPase 1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4271.37 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-170052

Macromolecules

Copper-transporting ATPase 1
Chain: A
Length: 75 amino acids
Theoretical weight: 8.19 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q04656 (Residues: 562-633; Coverage: 5%)
Gene names: ATP7A, MC1, MNK
Pfam: Heavy-metal-associated domain
InterPro:
CATH: Alpha-Beta Plaits
Copper-transporting ATPase 1 in PDB entry 1yju, assembly 1, front view.
Copper-transporting ATPase 1 in PDB entry 1yju, assembly 1, side view.
Copper-transporting ATPase 1 in PDB entry 1yju, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q04656  
17510203040506070
 
204060MGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKIE
UniProt
Q04656
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Quick links