› › Structure analysis

Solution structure of the Rhodobacter sphaeroides PufX membrane protein

Solution NMR
PDB entry 2dw3 coloured by chain, ensemble of 7 models, front view.
PDB entry 2dw3 coloured by chain, ensemble of 7 models, side view.
PDB entry 2dw3 coloured by chain, ensemble of 7 models, top view.
Source organism: Cereibacter sphaeroides
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: PUFX protien
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 8296.43 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-181352

Macromolecules

PUFX protien
Chain: A
Length: 77 amino acids
Theoretical weight: 8.65 KDa
Source organism: Cereibacter sphaeroides
Expression system: Escherichia coli BL21
UniProt:
  • Canonical: Q7B2Z6 (Residues: 2-72; Coverage: 87%)
Gene names: D1114_08765, pufX
Pfam: Intrinsic membrane protein PufX
InterPro: Intrinsic membrane protein family, PufX
CATH: rhodobacter sphaeroides pufx membrane protein
PUFX protien in PDB entry 2dw3, assembly 1, front view.
PUFX protien in PDB entry 2dw3, assembly 1, side view.
PUFX protien in PDB entry 2dw3, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q7B2Z6  
17710203040506070
 
204060ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITGALEHHHHHH
UniProt
Q7B2Z6
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Sequence conservation
Molecule details ›

Search similar proteins

Quick links