› › Fab Fragment (Light Chain)

Fab Fragment (Light Chain) in PDB entry 2exy, assembly 1, front view.
Fab Fragment (Light Chain) in PDB entry 2exy, assembly 1, side view.
Fab Fragment (Light Chain) in PDB entry 2exy, assembly 1, top view.
Chains: D, F
Length: 211 amino acids
Theoretical weight: 23.09 KDa
Source organism: Mus musculus
FASTA Sequence
>pdb|2exy|D F
DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA
Loading Protvista...
Loading...
 
 
  2exy:D 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...

Quick links

Search similar proteins