› › Structure analysis

Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M

X-ray diffraction
1.25Å resolution
PDB entry 2hba coloured by chain, front view.
PDB entry 2hba coloured by chain, side view.
PDB entry 2hba coloured by chain, top view.
Source organism: Geobacillus stearothermophilus
Assemblies composition:
monomeric (preferred)
homo tetramer
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1
Download    3D Visualisation
Assembly Name: Large ribosomal subunit protein bL9
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 3623.47 Å2
Buried surface area: 892.4 Å2
Dissociation area: 70.48 Å2
Dissociation energy (ΔGdiss): 15.18 kcal/mol
Dissociation entropy (TΔSdiss): 1.03 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-135840
Monomeric assembly 1 of PDB entry 2hba coloured by chemically distinct molecules, front view.
Monomeric assembly 1 of PDB entry 2hba coloured by chemically distinct molecules, side view.
Monomeric assembly 1 of PDB entry 2hba coloured by chemically distinct molecules, top view.
    Assembly 1
Confidence : 72%
No. subunits : 1
Symmetry : None
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of EPPIC but not of PISA
Assembly 2 (preferred)
Download    3D Visualisation
Assembly Name: Large ribosomal subunit protein bL9
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 3697.86 Å2
Buried surface area: 1470.22 Å2
Dissociation area: 100.21 Å2
Dissociation energy (ΔGdiss): 12.86 kcal/mol
Dissociation entropy (TΔSdiss): 2.77 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-135840
Monomeric assembly 2 of PDB entry 2hba coloured by chemically distinct molecules, front view.
Monomeric assembly 2 of PDB entry 2hba coloured by chemically distinct molecules, side view.
Monomeric assembly 2 of PDB entry 2hba coloured by chemically distinct molecules, top view.
    Assembly 2
Confidence : 72%
No. subunits : 1
Symmetry : None
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of EPPIC but not of PISA
Assembly 3
Download    3D Visualisation
Assembly Name: Large ribosomal subunit protein bL9
hide full assembly name
Multimeric state: homo tetramer
Accessible surface area: 10342.81 Å2
Buried surface area: 9021.17 Å2
Dissociation area: 889.14 Å2
Dissociation energy (ΔGdiss): 23.55 kcal/mol
Dissociation entropy (TΔSdiss): 11.19 kcal/mol
Symmetry number: 4
PDBe Complex ID: PDB-CPX-135845
Homo tetrameric assembly 3 of PDB entry 2hba coloured by chemically distinct molecules, front view.
Homo tetrameric assembly 3 of PDB entry 2hba coloured by chemically distinct molecules, side view.
Homo tetrameric assembly 3 of PDB entry 2hba coloured by chemically distinct molecules, top view.
    Assembly 3
Confidence : 87%
No. subunits : 4
Symmetry : D2
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of PISA but not of EPPIC
Assembly 4
Download    3D Visualisation
Assembly Name: Large ribosomal subunit protein bL9
hide full assembly name
Multimeric state: homo tetramer
Accessible surface area: 13270.47 Å2
Buried surface area: 6097.4 Å2
Dissociation area: 378.62 Å2
Dissociation energy (ΔGdiss): 28.44 kcal/mol
Dissociation entropy (TΔSdiss): 11.42 kcal/mol
Symmetry number: 4
PDBe Complex ID: PDB-CPX-135845
Homo tetrameric assembly 4 of PDB entry 2hba coloured by chemically distinct molecules, front view.
Homo tetrameric assembly 4 of PDB entry 2hba coloured by chemically distinct molecules, side view.
Homo tetrameric assembly 4 of PDB entry 2hba coloured by chemically distinct molecules, top view.
Record not found!

Macromolecules

Large ribosomal subunit protein bL9
Chains: A, B
Length: 52 amino acids
Theoretical weight: 5.69 KDa
Source organism: Geobacillus stearothermophilus
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: P02417 (Residues: 1-52; Coverage: 35%)
Gene name: rplI
Pfam: Ribosomal protein L9, N-terminal domain
InterPro:
CATH: Ribosomal protein L9, N-terminal domain
SCOP: Ribosomal protein L9 N-domain
Large ribosomal subunit protein bL9 in PDB entry 2hba, assembly 2, front view.
Large ribosomal subunit protein bL9 in PDB entry 2hba, assembly 2, side view.
Large ribosomal subunit protein bL9 in PDB entry 2hba, assembly 2, top view.
PDBe-KB: UniProt Coverage View: P02417  
1525101520253035404550
 
2040MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ
UniProt
P02417
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links