pH-gated potassium channel KcsA in PDB entry 2ih1 ‹ PDBe

Chain: C
Length: 122 amino acids
Theoretical weight: 13.03 KDa
Source organism: Streptomyces lividans
Expression system: Escherichia coli
UniProt:

Canonical: P0A334 (Residues: 3-122; Coverage: 75%)

Gene names: kcsA, skc1
FASTA Sequence


    >pdb|2ih1|C

MAPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVAYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR

2ih1:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.