› › Structure analysis

Solution structure of the p8 TFIIH subunit

Solution NMR
PDB entry 2jnj coloured by chain, ensemble of 10 models, front view.
PDB entry 2jnj coloured by chain, ensemble of 10 models, side view.
PDB entry 2jnj coloured by chain, ensemble of 10 models, top view.
Source organism: Homo sapiens
Assembly composition:
homo dimer (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: General transcription factor IIH subunit 5
hide full assembly name
Multimeric state: homo dimer
Accessible surface area: 9575.61 Å2
Buried surface area: 1624.44 Å2
Dissociation area: 812.22 Å2
Dissociation energy (ΔGdiss): 5.67 kcal/mol
Dissociation entropy (TΔSdiss): 10.73 kcal/mol
Symmetry number: 2
PDBe Complex ID: PDB-CPX-180619

Macromolecules

General transcription factor IIH subunit 5
Chains: A, B
Length: 74 amino acids
Theoretical weight: 8.34 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q6ZYL4 (Residues: 1-71; Coverage: 100%)
Gene names: C6orf175, GTF2H5, TTDA
Pfam: Transcription factor TFIIH complex subunit Tfb5
InterPro:
CATH: TFB5-like
General transcription factor IIH subunit 5 in PDB entry 2jnj, assembly 1, front view.
General transcription factor IIH subunit 5 in PDB entry 2jnj, assembly 1, side view.
General transcription factor IIH subunit 5 in PDB entry 2jnj, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q6ZYL4  
17410203040506070
 
204060GSHMVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK
UniProt
Q6ZYL4
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Quick links