› › Structure analysis

Solution structure of M7, a computationally-designed artificial protein

Solution NMR
PDB entry 2jvf coloured by chain, ensemble of 20 models, front view.
PDB entry 2jvf coloured by chain, ensemble of 20 models, side view.
PDB entry 2jvf coloured by chain, ensemble of 20 models, top view.
Source organism: unidentified
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: De novo protein m7
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 6132.56 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-162799

Macromolecules

de novo protein M7
Chain: A
Length: 96 amino acids
Theoretical weight: 10.84 KDa
Source organism: unidentified
Expression system: Escherichia coli BL21(DE3)
CATH: top7, de novo designed protein
SCOP: alpha+beta folds
de novo protein M7 in PDB entry 2jvf, assembly 1, front view.
de novo protein M7 in PDB entry 2jvf, assembly 1, side view.
de novo protein M7 in PDB entry 2jvf, assembly 1, top view.
196102030405060708090
 
50GSHMKVDITIKIQRDGQEIEIDIRVSTGKELERALQELEKALARAGARNVQITISAENDEQAKELLELIARLLQKLGYKDINVRVNGTEVKIEVRV
Chains
Chain A (auth A)
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Quick links