› › Structure analysis

Solution NMR Structure of BCMA

Solution NMR
PDB entry 2kn1 coloured by chain, ensemble of 20 models, front view.
PDB entry 2kn1 coloured by chain, ensemble of 20 models, side view.
PDB entry 2kn1 coloured by chain, ensemble of 20 models, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Tumor necrosis factor receptor superfamily member 17
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4332.56 Å2
Buried surface area: 100.79 Å2
Dissociation area: 50.4 Å2
Dissociation energy (ΔGdiss): 4.37 kcal/mol
Dissociation entropy (TΔSdiss): -4.54 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-169688

Macromolecules

Tumor necrosis factor receptor superfamily member 17
Chain: A
Length: 51 amino acids
Theoretical weight: 5.6 KDa
Source organism: Homo sapiens
Expression system: Not provided
UniProt:
  • Canonical: Q02223 (Residues: 2-50; Coverage: 27%)
Gene names: BCM, BCMA, TNFRSF17
Pfam: BCMA, TALL-1 binding
InterPro:
CATH: Tumor necrosis factor receptor superfamily
Tumor necrosis factor receptor superfamily member 17 in PDB entry 2kn1, assembly 1, front view.
Tumor necrosis factor receptor superfamily member 17 in PDB entry 2kn1, assembly 1, side view.
Tumor necrosis factor receptor superfamily member 17 in PDB entry 2kn1, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q02223  
1515101520253035404550
 
2040LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK**
UniProt
Q02223
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Sequence conservation
Molecule details ›

Search similar proteins

Quick links