› › Structure analysis

Solution NMR structure of the influenza A virus S31N mutant (19-49) in presence of drug M2WJ332

Solution NMR
PDB entry 2ly0 coloured by chain, ensemble of 20 models, front view.
PDB entry 2ly0 coloured by chain, ensemble of 20 models, side view.
PDB entry 2ly0 coloured by chain, ensemble of 20 models, top view.
Source organism: Influenza A virus (A/Chiba/5/71(H3N2))
Assembly composition:
homo tetramer (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Matrix protein 2
hide full assembly name
Multimeric state: homo tetramer
Accessible surface area: 9499.83 Å2
Buried surface area: 3759.54 Å2
Dissociation area: 1,879.77 Å2
Dissociation energy (ΔGdiss): -7.15 kcal/mol
Dissociation entropy (TΔSdiss): 28.82 kcal/mol
Symmetry number: 4
PDBe Complex ID: PDB-CPX-180537

Macromolecules

Matrix protein 2
Chains: A, B, C, D
Length: 31 amino acids
Theoretical weight: 3.5 KDa
Source organism: Influenza A virus (A/Chiba/5/71(H3N2))
Expression system: Not provided
UniProt:
  • Canonical: Q6XT21 (Residues: 20-49; Coverage: 31%)
Gene name: M
Pfam: Influenza Matrix protein (M2)
InterPro: Influenza virus matrix protein 2
Matrix protein 2 in PDB entry 2ly0, assembly 1, front view.
Matrix protein 2 in PDB entry 2ly0, assembly 1, side view.
Matrix protein 2 in PDB entry 2ly0, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q6XT21  
13124681012141618202224262830
 
102030SNDSSDPLVVAANIIGILHLILWILDRLFFK
UniProt
Q6XT21
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Interaction interfaces
Sequence conservation
Molecule details ›

Search similar proteins

Quick links