mRNA-decapping enzyme C-terminal domain-containing protein

Chain: A
Length: 134 amino acids
Theoretical weight: 15.47 KDa
Source organism: Drosophila melanogaster
Expression system: Escherichia coli
UniProt:
  • Canonical: Q9W1H5 (Residues: 1-127; Coverage: 34%)
Gene names: CG11183, DCP1, Dcp-1, Dcp1, Dcp1p, Dmel\CG11183, Dmel_CG11183, anon-WO0118547.163, dDCP1, dDcp1, dcp-1
FASTA Sequence
>pdb|2lyd|A
GPHMADLMADESITRMNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHSIFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSK
PDBe-KB: UniProt Coverage View: Q9W1H5  
Loading Protvista...
Loading...
 
 
  2lyd: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...