Protein kinase C alpha type

Chain: A
Length: 139 amino acids
Theoretical weight: 16.24 KDa
Source organism: Rattus norvegicus
Expression system: Escherichia coli
UniProt:
  • Canonical: P05696 (Residues: 155-293; Coverage: 21%)
Gene names: Pkca, Prkca
FASTA Sequence
>pdb|2nce|A
HTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEG
PDBe-KB: UniProt Coverage View: P05696  
Loading Protvista...
Loading...
 
 
  2nce: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...