› › Structure analysis

1.15 Angstrom Crystal Structure of the MA3 domain of Pdcd4

X-ray diffraction
1.15Å resolution
PDB entry 2nsz coloured by chain, front view.
PDB entry 2nsz coloured by chain, side view.
PDB entry 2nsz coloured by chain, top view.
Source organism: Mus musculus
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Programmed cell death protein 4
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 7152.49 Å2
Buried surface area: 514.09 Å2
Dissociation area: 94.37 Å2
Dissociation energy (ΔGdiss): -1.19 kcal/mol
Dissociation entropy (TΔSdiss): 0.8 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-178902
Monomeric assembly 1 of PDB entry 2nsz coloured by chemically distinct molecules, front view.
Monomeric assembly 1 of PDB entry 2nsz coloured by chemically distinct molecules, side view.
Monomeric assembly 1 of PDB entry 2nsz coloured by chemically distinct molecules, top view.
    Assembly 1
Confidence : 95%
No. subunits : 1
Symmetry : None
More details
3DComplex & QSbio predictionx
No. subunits : 1
Symmetry : None
Evidence : This biological assembly agrees with the prediction of both PISA & EPPIC

Macromolecules

Programmed cell death protein 4
Chain: A
Length: 129 amino acids
Theoretical weight: 15.01 KDa
Source organism: Mus musculus
Expression system: Escherichia coli
UniProt:
  • Canonical: Q61823 (Residues: 322-450; Coverage: 28%)
Gene names: Ma3, Pdcd4, Tis
Pfam: MA3 domain
InterPro:
CATH: Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
SCOP: MIF4G domain-like
Programmed cell death protein 4 in PDB entry 2nsz, assembly 1, front view.
Programmed cell death protein 4 in PDB entry 2nsz, assembly 1, side view.
Programmed cell death protein 4 in PDB entry 2nsz, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q61823  
1129102030405060708090100110120
 
50100QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
UniProt
Q61823
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links