› › Structure analysis

Solution structure of the presumed chromodomain of the yeast histone acetyltransferase, Esa1

Solution NMR
PDB entry 2rnz coloured by chain, ensemble of 20 models, front view.
PDB entry 2rnz coloured by chain, ensemble of 20 models, side view.
PDB entry 2rnz coloured by chain, ensemble of 20 models, top view.
Source organism: Saccharomyces cerevisiae
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Histone acetyltransferase ESA1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 8804.9 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-170671

Macromolecules

Histone acetyltransferase ESA1
Chain: A
Length: 94 amino acids
Theoretical weight: 11.07 KDa
Source organism: Saccharomyces cerevisiae
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q08649 (Residues: 17-89; Coverage: 16%)
Gene names: ESA1, O5257, YOR244W
Pfam: RNA binding activity-knot of a chromodomain
InterPro:
Histone acetyltransferase ESA1 in PDB entry 2rnz, assembly 1, front view.
Histone acetyltransferase ESA1 in PDB entry 2rnz, assembly 1, side view.
Histone acetyltransferase ESA1 in PDB entry 2rnz, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q08649  
194102030405060708090
 
20406080MGSSHHHHHHSSGLVPRGSHMSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDED
UniProt
Q08649
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Sequence conservation
Molecule details ›

Search similar proteins

Quick links