› › Structure analysis

The C1 domain of ROCK II

Solution NMR
PDB entry 2row coloured by chain, ensemble of 20 models, front view.
PDB entry 2row coloured by chain, ensemble of 20 models, side view.
PDB entry 2row coloured by chain, ensemble of 20 models, top view.
Source organism: Rattus norvegicus
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Rho-associated protein kinase 2
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 7050.38 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-178974

Macromolecules

Rho-associated protein kinase 2
Chain: A
Length: 84 amino acids
Theoretical weight: 10.01 KDa
Source organism: Rattus norvegicus
Expression system: Escherichia coli
UniProt:
  • Canonical: Q62868 (Residues: 1237-1320; Coverage: 6%)
Gene name: Rock2
InterPro:
CATH: Wheat Germ Agglutinin (Isolectin 2); domain 1
Rho-associated protein kinase 2 in PDB entry 2row, assembly 1, front view.
Rho-associated protein kinase 2 in PDB entry 2row, assembly 1, side view.
Rho-associated protein kinase 2 in PDB entry 2row, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q62868  
1841020304050607080
 
20406080ESKKEPEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
UniProt
Q62868
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Molecule details ›

Search similar proteins

Quick links