› › Structure analysis

Structure of TR-alfa bound to selective thyromimetic GC-1 in C2 space group

X-ray diffraction
2.5Å resolution
PDB entry 3hzf coloured by chain, front view.
PDB entry 3hzf coloured by chain, side view.
PDB entry 3hzf coloured by chain, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Thyroid hormone receptor alpha
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 13122.58 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-145479

Macromolecules

Thyroid hormone receptor alpha
Chain: A
Length: 269 amino acids
Theoretical weight: 31.01 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P10827 (Residues: 148-370; Coverage: 46%)
  • Best match: P10827-2 (Residues: 148-410)
Gene names: EAR7, ERBA1, NR1A1, THRA, THRA1, THRA2
Pfam: Ligand-binding domain of nuclear hormone receptor
InterPro:
CATH: Retinoid X Receptor
Thyroid hormone receptor alpha in PDB entry 3hzf, assembly 1, front view.
Thyroid hormone receptor alpha in PDB entry 3hzf, assembly 1, side view.
Thyroid hormone receptor alpha in PDB entry 3hzf, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P10827  
126920406080100120140160180200220240260
 
100200ARGSHMEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELP*EDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLL*VDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDLRMIGA*HASRFLHMKVE*PTELFPPLFLEVFEDQEV
UniProt
P10827
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links