Preflagellin peptidase

Chains: A, B
Length: 237 amino acids
Theoretical weight: 27.08 KDa
Source organism: Methanococcus maripaludis
Expression system: Escherichia coli BL21
UniProt:
  • Canonical: A9A677 (Residues: 1-230; Coverage: 100%)
Gene names: MmarC6_0338, flaK
FASTA Sequence
>pdb|3s0x|A B
GSHGSGSMIEYIIGALGLIIASVQDFRSREIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPAADDEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLIPF
PDBe-KB: UniProt Coverage View: A9A677  
Loading Protvista...
Loading...
 
 
  3s0x: 

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.

Loading Protvista...