› › Structure analysis

X-ray crystal structure of the K33S mutant of ubiquitin

X-ray diffraction
1.5Å resolution
PDB entry 4pih coloured by chain, front view.
PDB entry 4pih coloured by chain, side view.
PDB entry 4pih coloured by chain, top view.
Source organism: Homo sapiens
Assemblies composition:
monomeric (preferred)
homo dimer
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Ubiquitin
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4845.42 Å2
Buried surface area: 185.85 Å2
Dissociation area: 48.5 Å2
Dissociation energy (ΔGdiss): 7.18 kcal/mol
Dissociation entropy (TΔSdiss): -0.84 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-158832
Monomeric assembly 1 of PDB entry 4pih coloured by chemically distinct molecules, front view.
Monomeric assembly 1 of PDB entry 4pih coloured by chemically distinct molecules, side view.
Monomeric assembly 1 of PDB entry 4pih coloured by chemically distinct molecules, top view.
    Assembly 1
Confidence : 72%
No. subunits : 1
Symmetry : None
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of EPPIC but not of PISA
Assembly 2
Download    3D Visualisation
Assembly Name: Ubiquitin
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4558.92 Å2
Buried surface area: 299.34 Å2
Dissociation area: 35.09 Å2
Dissociation energy (ΔGdiss): 6.43 kcal/mol
Dissociation entropy (TΔSdiss): 0.03 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-158832
Monomeric assembly 2 of PDB entry 4pih coloured by chemically distinct molecules, front view.
Monomeric assembly 2 of PDB entry 4pih coloured by chemically distinct molecules, side view.
Monomeric assembly 2 of PDB entry 4pih coloured by chemically distinct molecules, top view.
    Assembly 2
Confidence : 72%
No. subunits : 1
Symmetry : None
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of EPPIC but not of PISA
Assembly 3
Download    3D Visualisation
Assembly Name: Ubiquitin
hide full assembly name
Multimeric state: homo dimer
Accessible surface area: 7826.34 Å2
Buried surface area: 2063.19 Å2
Dissociation area: 108.69 Å2
Dissociation energy (ΔGdiss): 14.3 kcal/mol
Dissociation entropy (TΔSdiss): -0.82 kcal/mol
Symmetry number: 2
PDBe Complex ID: PDB-CPX-158843
Homo dimeric assembly 3 of PDB entry 4pih coloured by chemically distinct molecules, front view.
Homo dimeric assembly 3 of PDB entry 4pih coloured by chemically distinct molecules, side view.
Homo dimeric assembly 3 of PDB entry 4pih coloured by chemically distinct molecules, top view.
    Assembly 3
Confidence : 89%
No. subunits : 2
Symmetry : C2
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with the prediction of PISA but not of EPPIC
Assembly 4
Download    3D Visualisation
Assembly Name: Ubiquitin
hide full assembly name
Multimeric state: homo dimer
Accessible surface area: 8409.71 Å2
Buried surface area: 1479.82 Å2
Dissociation area: 488.02 Å2
Dissociation energy (ΔGdiss): 2.73 kcal/mol
Dissociation entropy (TΔSdiss): 9.98 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-158843
Homo dimeric assembly 4 of PDB entry 4pih coloured by chemically distinct molecules, front view.
Homo dimeric assembly 4 of PDB entry 4pih coloured by chemically distinct molecules, side view.
Homo dimeric assembly 4 of PDB entry 4pih coloured by chemically distinct molecules, top view.
    Assembly 4
Confidence : 48%
No. subunits : 2
Symmetry : C2
More details
3DComplex & QSbio predictionx
No. subunits : Unclear
Symmetry : Unclear
Evidence : This biological assembly agrees with none of the predictions of PISA & EPPIC

Macromolecules

Ubiquitin
Chains: A, B
Length: 76 amino acids
Theoretical weight: 8.53 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P62987 (Residues: 1-76; Coverage: 59%)
Gene names: UBA52, UBCEP2
Pfam: Ubiquitin family
InterPro:
Ubiquitin in PDB entry 4pih, assembly 1, front view.
Ubiquitin in PDB entry 4pih, assembly 1, side view.
Ubiquitin in PDB entry 4pih, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P62987  
17610203040506070
 
204060MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDSEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
UniProt
P62987
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links