› › Structure analysis

Crystal structure of the E. coli ribosome bound to flopristin.

X-ray diffraction
2.9Å resolution
PDB entry 4u20 coloured by chain, front view.
PDB entry 4u20 coloured by chain, side view.
PDB entry 4u20 coloured by chain, top view.
Source organisms:
Assemblies composition:
hetero 53-mer (preferred)
hetero 52-mer
Entry contents: 50 distinct polypeptide molecules
3 distinct RNA molecules

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: ribosomal protein
hide full assembly name
Multimeric state: hetero 53-mer
Accessible surface area: 773836.89 Å2
Buried surface area: 274191.7 Å2
Dissociation area: 632.46 Å2
Dissociation energy (ΔGdiss): -2.94 kcal/mol
Dissociation entropy (TΔSdiss): 13.62 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-293367
Assembly 2
Download    3D Visualisation
Assembly Name: ribosomal protein
hide full assembly name
Multimeric state: hetero 52-mer
Accessible surface area: 761701.23 Å2
Buried surface area: 267201.62 Å2
Dissociation area: 615.48 Å2
Dissociation energy (ΔGdiss): -5.37 kcal/mol
Dissociation entropy (TΔSdiss): 13.6 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-293371

Macromolecules

Small ribosomal subunit protein uS2
Chains: AB, CB
Length: 218 amino acids
Theoretical weight: 24.25 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7V0 (Residues: 9-226; Coverage: 91%)
Gene names: JW0164, b0169, rpsB
Pfam: Ribosomal protein S2
InterPro:
Small ribosomal subunit protein uS2 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS2 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS2 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V0  
121820406080100120140160180200
 
100200
UniProt
P0A7V0
Chains
Domains
Flexibility predictions
Early folding residue predictions
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS3
Chains: AC, CC
Length: 206 amino acids
Theoretical weight: 23.08 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7V3 (Residues: 2-207; Coverage: 88%)
Gene names: JW3276, b3314, rpsC
Pfam:
InterPro:
Small ribosomal subunit protein uS3 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS3 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS3 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V3  
120620406080100120140160180200
 
50100150200
UniProt
P0A7V3
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS4
Chains: AD, CD
Length: 205 amino acids
Theoretical weight: 23.38 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7V8 (Residues: 2-206; Coverage: 100%)
Gene names: JW3258, b3296, ramA, rpsD
Pfam:
InterPro:
Small ribosomal subunit protein uS4 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS4 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS4 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7V8  
120520406080100120140160180200
 
50100150200
UniProt
P0A7V8
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS5
Chains: AE, CE
Length: 150 amino acids
Theoretical weight: 15.8 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7W1 (Residues: 10-159; Coverage: 90%)
Gene names: JW3265, b3303, rpsE, spc
Pfam:
InterPro:
Small ribosomal subunit protein uS5 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS5 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS5 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7W1  
115020406080100120140
 
50100150
UniProt
P0A7W1
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS6, non-modified isoform
Chains: AF, CF
Length: 100 amino acids
Theoretical weight: 11.67 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P02358 (Residues: 1-100; Coverage: 74%)
Gene names: JW4158, b4200, rpsF
Pfam: Ribosomal protein S6
InterPro:
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein bS6, non-modified isoform in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02358  
1100102030405060708090100
 
50100MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS
UniProt
P02358
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS7
Chains: AG, CG
Length: 151 amino acids
Theoretical weight: 16.86 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P02359 (Residues: 2-152; Coverage: 84%)
Gene names: JW3303, b3341, rpsG
Pfam: Ribosomal protein S7p/S5e
InterPro:
Small ribosomal subunit protein uS7 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS7 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS7 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02359  
115120406080100120140
 
50100150
UniProt
P02359
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS8
Chains: AH, CH
Length: 129 amino acids
Theoretical weight: 14.02 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7W7 (Residues: 2-130; Coverage: 99%)
Gene names: JW3268, b3306, rpsH
Pfam: Ribosomal protein S8
InterPro:
Small ribosomal subunit protein uS8 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS8 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS8 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7W7  
1129102030405060708090100110120
 
50100
UniProt
P0A7W7
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS9
Chains: AI, CI
Length: 127 amino acids
Theoretical weight: 14.55 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7X3 (Residues: 4-130; Coverage: 98%)
Gene names: JW3199, b3230, rpsI
Pfam: Ribosomal protein S9/S16
InterPro:
Small ribosomal subunit protein uS9 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS9 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS9 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7X3  
1127102030405060708090100110120
 
50100
UniProt
P0A7X3
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS10
Chains: AJ, CJ
Length: 98 amino acids
Theoretical weight: 11.2 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7R5 (Residues: 5-102; Coverage: 95%)
Gene names: JW3283, b3321, nusE, rpsJ
Pfam: Ribosomal protein S10p/S20e
InterPro:
Small ribosomal subunit protein uS10 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS10 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS10 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R5  
198102030405060708090
 
50RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
UniProt
P0A7R5
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS11
Chains: AK, CK
Length: 117 amino acids
Theoretical weight: 12.49 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7R9 (Residues: 13-129; Coverage: 91%)
Gene names: JW3259, b3297, rpsK
Pfam: Ribosomal protein S11
InterPro:
Small ribosomal subunit protein uS11 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS11 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS11 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R9  
1117102030405060708090100110
 
50100
UniProt
P0A7R9
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS12
Chains: AL, CL
Length: 123 amino acids
Theoretical weight: 13.64 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7S3 (Residues: 2-124; Coverage: 99%)
Gene names: JW3304, b3342, rpsL, strA
Pfam: Ribosomal protein S12/S23
InterPro:
Small ribosomal subunit protein uS12 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS12 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS12 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7S3  
1123102030405060708090100110120
 
50100
UniProt
P0A7S3
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS13
Chains: AM, CM
Length: 114 amino acids
Theoretical weight: 12.63 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7S9 (Residues: 2-115; Coverage: 97%)
Gene names: JW3260, b3298, rpsM
Pfam: Ribosomal protein S13/S18
InterPro:
Small ribosomal subunit protein uS13 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS13 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS13 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7S9  
1114102030405060708090100110
 
50100
UniProt
P0A7S9
Chains
Domains
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS14
Chains: AN, CN
Length: 100 amino acids
Theoretical weight: 11.48 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG59 (Residues: 2-101; Coverage: 99%)
Gene names: JW3269, b3307, rpsN
Pfam: Ribosomal protein S14p/S29e
InterPro:
Small ribosomal subunit protein uS14 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS14 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS14 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG59  
1100102030405060708090100
 
50100AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
UniProt
P0AG59
Chains
Domains
Flexibility predictions
Early folding residue predictions
Interaction interfaces
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS15
Chains: AO, CO
Length: 88 amino acids
Theoretical weight: 10.16 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0ADZ4 (Residues: 2-89; Coverage: 99%)
Gene names: JW3134, b3165, rpsO, secC
Pfam: Ribosomal protein S15
InterPro:
Small ribosomal subunit protein uS15 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS15 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS15 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADZ4  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS16
Chains: AP, CP
Length: 82 amino acids
Theoretical weight: 9.21 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7T3 (Residues: 1-82; Coverage: 100%)
Gene names: JW2590, b2609, rpsP
Pfam: Ribosomal protein S16
InterPro:
Small ribosomal subunit protein bS16 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein bS16 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein bS16 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7T3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS17
Chains: AQ, CQ
Length: 80 amino acids
Theoretical weight: 9.26 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG63 (Residues: 4-83; Coverage: 95%)
Gene names: JW3273, b3311, neaA, rpsQ
Pfam: Ribosomal protein S17
InterPro:
Small ribosomal subunit protein uS17 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS17 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS17 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG63  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS18
Chains: AR, CR
Length: 55 amino acids
Theoretical weight: 6.47 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7T7 (Residues: 20-74; Coverage: 73%)
Gene names: JW4160, b4202, rpsR
Pfam: Ribosomal protein S18
InterPro:
Small ribosomal subunit protein bS18 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein bS18 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein bS18 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7T7  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein uS19
Chains: AS, CS
Length: 79 amino acids
Theoretical weight: 9.06 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7U3 (Residues: 3-81; Coverage: 86%)
Gene names: JW3278, b3316, rpsS
Pfam: Ribosomal protein S19
InterPro:
Small ribosomal subunit protein uS19 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein uS19 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein uS19 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7U3  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS20
Chains: AT, CT
Length: 85 amino acids
Theoretical weight: 9.51 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7U7 (Residues: 3-87; Coverage: 98%)
Gene names: JW0022, b0023, rpsT
Pfam: Ribosomal protein S20
InterPro:
Small ribosomal subunit protein bS20 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein bS20 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein bS20 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7U7  
Loading Protvista...
Molecule details ›

Search similar proteins

Small ribosomal subunit protein bS21
Chains: AU, CU
Length: 51 amino acids
Theoretical weight: 6.07 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P68679 (Residues: 4-54; Coverage: 72%)
Gene names: JW3037, b3065, rpsU
Pfam: Ribosomal protein S21
InterPro:
Small ribosomal subunit protein bS21 in PDB entry 4u20, assembly 1, front view.
Small ribosomal subunit protein bS21 in PDB entry 4u20, assembly 1, side view.
Small ribosomal subunit protein bS21 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P68679  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL2
Chains: BC, DC
Length: 271 amino acids
Theoretical weight: 29.66 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P60422 (Residues: 2-272; Coverage: 99%)
Gene names: JW3279, b3317, rplB
Pfam:
InterPro:
Large ribosomal subunit protein uL2 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL2 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL2 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60422  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL3
Chains: BD, DD
Length: 209 amino acids
Theoretical weight: 22.28 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P60438 (Residues: 1-209; Coverage: 100%)
Gene names: JW3282, b3320, rplC
Pfam: Ribosomal protein L3
InterPro:
Large ribosomal subunit protein uL3 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL3 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL3 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60438  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL4
Chains: BE, DE
Length: 201 amino acids
Theoretical weight: 22.12 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P60723 (Residues: 1-201; Coverage: 100%)
Gene names: JW3281, b3319, eryA, rplD
Pfam: Ribosomal protein L4/L1 family
InterPro:
Large ribosomal subunit protein uL4 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL4 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL4 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60723  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL5
Chains: BF, DF
Length: 177 amino acids
Theoretical weight: 20.07 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P62399 (Residues: 2-178; Coverage: 99%)
Gene names: JW3270, b3308, rplE
Pfam:
InterPro:
Large ribosomal subunit protein uL5 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL5 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL5 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P62399  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL6
Chains: BG, DG
Length: 176 amino acids
Theoretical weight: 18.8 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG55 (Residues: 2-177; Coverage: 99%)
Gene names: JW3267, b3305, rplF
Pfam: Ribosomal protein L6
InterPro:
Large ribosomal subunit protein uL6 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL6 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL6 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG55  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL9
Chains: BH, DH
Length: 149 amino acids
Theoretical weight: 15.79 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7R1 (Residues: 1-149; Coverage: 100%)
Gene names: JW4161, b4203, rplI
Pfam:
InterPro:
Large ribosomal subunit protein bL9 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL9 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL9 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7R1  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL11
Chains: BI, DI
Length: 141 amino acids
Theoretical weight: 14.76 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7J7 (Residues: 2-142; Coverage: 99%)
Gene names: JW3946, b3983, relC, rplK
Pfam:
InterPro:
Large ribosomal subunit protein uL11 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL11 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL11 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7J7  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL13
Chains: BJ, DJ
Length: 142 amino acids
Theoretical weight: 16.05 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AA10 (Residues: 1-142; Coverage: 100%)
Gene names: JW3200, b3231, rplM
Pfam: Ribosomal protein L13
InterPro:
Large ribosomal subunit protein uL13 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL13 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL13 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AA10  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL14
Chains: BK, DK
Length: 122 amino acids
Theoretical weight: 13.45 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0ADY3 (Residues: 1-122; Coverage: 99%)
Gene names: JW3272, b3310, rplN
Pfam: Ribosomal protein L14p/L23e
InterPro:
Large ribosomal subunit protein uL14 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL14 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL14 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADY3  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL15
Chains: BL, DL
Length: 143 amino acids
Theoretical weight: 14.88 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P02413 (Residues: 2-144; Coverage: 99%)
Gene names: JW3263, b3301, rplO
Pfam: Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
InterPro:
Large ribosomal subunit protein uL15 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL15 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL15 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P02413  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL16
Chains: BM, DM
Length: 136 amino acids
Theoretical weight: 15.31 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0ADY7 (Residues: 1-136; Coverage: 100%)
Gene names: JW3275, b3313, rplP
Pfam: Ribosomal protein L16p/L10e
InterPro:
Large ribosomal subunit protein uL16 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL16 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL16 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADY7  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL17
Chains: BN, DN
Length: 120 amino acids
Theoretical weight: 13.72 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG44 (Residues: 1-120; Coverage: 95%)
Gene names: JW3256, b3294, rplQ
Pfam: Ribosomal protein L17
InterPro:
Large ribosomal subunit protein bL17 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL17 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL17 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG44  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL18
Chains: BO, DO
Length: 116 amino acids
Theoretical weight: 12.66 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0C018 (Residues: 2-117; Coverage: 99%)
Gene names: JW3266, b3304, rplR
Pfam: Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
InterPro:
Large ribosomal subunit protein uL18 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL18 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL18 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0C018  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL19
Chains: BP, DP
Length: 114 amino acids
Theoretical weight: 13.03 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7K6 (Residues: 2-115; Coverage: 99%)
Gene names: JW2587, b2606, rplS
Pfam: Ribosomal protein L19
InterPro:
Large ribosomal subunit protein bL19 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL19 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL19 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7K6  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL20
Chains: BQ, DQ
Length: 117 amino acids
Theoretical weight: 13.4 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7L3 (Residues: 2-118; Coverage: 99%)
Gene names: JW1706, b1716, pdzA, rplT
Pfam: Ribosomal protein L20
InterPro:
Large ribosomal subunit protein bL20 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL20 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL20 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7L3  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL21
Chains: BR, DR
Length: 103 amino acids
Theoretical weight: 11.59 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG48 (Residues: 1-103; Coverage: 100%)
Gene names: JW3153, b3186, rplU
Pfam: Ribosomal prokaryotic L21 protein
InterPro:
Large ribosomal subunit protein bL21 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL21 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL21 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG48  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL22
Chains: BS, DS
Length: 110 amino acids
Theoretical weight: 12.25 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P61175 (Residues: 1-110; Coverage: 100%)
Gene names: JW3277, b3315, eryB, rplV
Pfam: Ribosomal protein L22p/L17e
InterPro:
Large ribosomal subunit protein uL22 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL22 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL22 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P61175  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL23
Chains: BT, DT
Length: 93 amino acids
Theoretical weight: 10.55 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0ADZ0 (Residues: 1-93; Coverage: 93%)
Gene names: JW3280, b3318, rplW
Pfam: Ribosomal protein L23
InterPro:
Large ribosomal subunit protein uL23 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL23 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL23 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0ADZ0  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL24
Chains: BU, DU
Length: 102 amino acids
Theoretical weight: 11.08 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P60624 (Residues: 2-103; Coverage: 98%)
Gene names: JW3271, b3309, rplX
Pfam:
InterPro:
Large ribosomal subunit protein uL24 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL24 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL24 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P60624  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL25
Chains: BV, DV
Length: 94 amino acids
Theoretical weight: 10.71 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P68919 (Residues: 1-94; Coverage: 100%)
Gene names: JW2173, b2185, rplY
Pfam: Ribosomal L25p family
InterPro:
Large ribosomal subunit protein bL25 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL25 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL25 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P68919  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL27
Chains: BW, DW
Length: 76 amino acids
Theoretical weight: 8.28 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7L8 (Residues: 10-85; Coverage: 89%)
Gene names: JW3152, b3185, rpmA
Pfam: Ribosomal L27 protein
InterPro:
Large ribosomal subunit protein bL27 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL27 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL27 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7L8  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL28
Chains: BX, DX
Length: 77 amino acids
Theoretical weight: 8.9 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7M2 (Residues: 2-78; Coverage: 99%)
Gene names: JW3612, b3637, rpmB
Pfam: Ribosomal L28 family
InterPro:
Large ribosomal subunit protein bL28 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL28 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL28 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7M2  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL29
Chains: BY, DY
Length: 63 amino acids
Theoretical weight: 7.29 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7M6 (Residues: 1-63; Coverage: 100%)
Gene names: JW3274, b3312, rpmC
Pfam: Ribosomal L29 protein
InterPro:
Large ribosomal subunit protein uL29 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL29 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL29 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7M6  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL30
Chains: BZ, DZ
Length: 58 amino acids
Theoretical weight: 6.42 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0AG51 (Residues: 2-59; Coverage: 98%)
Gene names: JW3264, b3302, rpmD
Pfam: Ribosomal protein L30p/L7e
InterPro:
Large ribosomal subunit protein uL30 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL30 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL30 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0AG51  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL32
Chains: B0, D0
Length: 56 amino acids
Theoretical weight: 6.33 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7N4 (Residues: 2-57; Coverage: 98%)
Gene names: JW1075, b1089, rpmF
Pfam: Ribosomal L32p protein family
InterPro:
Large ribosomal subunit protein bL32 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL32 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL32 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7N4  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL33
Chains: B1, D1
Length: 50 amino acids
Theoretical weight: 5.81 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7N9 (Residues: 4-53; Coverage: 91%)
Gene names: JW3611, b3636, rpmG
Pfam: Ribosomal protein L33
InterPro:
Large ribosomal subunit protein bL33 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL33 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL33 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7N9  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL34
Chains: B2, D2
Length: 46 amino acids
Theoretical weight: 5.4 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7P5 (Residues: 1-46; Coverage: 100%)
Gene names: JW3680, b3703, rimA, rpmH, ssaF
Pfam: Ribosomal protein L34
InterPro:
Large ribosomal subunit protein bL34 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL34 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL34 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7P5  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL35
Chains: B3, D3
Length: 64 amino acids
Theoretical weight: 7.18 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7Q1 (Residues: 2-65; Coverage: 99%)
Gene names: JW1707, b1717, rpmI
Pfam: Ribosomal protein L35
InterPro:
Large ribosomal subunit protein bL35 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL35 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL35 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7Q1  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein bL36A
Chains: B4, D4
Length: 38 amino acids
Theoretical weight: 4.38 KDa
Source organism: Escherichia coli K-12
UniProt:
  • Canonical: P0A7Q6 (Residues: 1-38; Coverage: 100%)
Gene names: JW3261, b3299, rpmJ
Pfam: Ribosomal protein L36
InterPro:
Large ribosomal subunit protein bL36A in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein bL36A in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein bL36A in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: P0A7Q6  
Loading Protvista...
Molecule details ›

Search similar proteins

Large ribosomal subunit protein uL1
Chain: B5
Length: 228 amino acids
Theoretical weight: 24.74 KDa
Source organism: Thermus thermophilus HB8
UniProt:
  • Canonical: Q5SLP7 (Residues: 2-229; Coverage: 100%)
Gene names: TTHA0246, rplA
Pfam: Ribosomal protein L1p/L10e family
InterPro:
Large ribosomal subunit protein uL1 in PDB entry 4u20, assembly 1, front view.
Large ribosomal subunit protein uL1 in PDB entry 4u20, assembly 1, side view.
Large ribosomal subunit protein uL1 in PDB entry 4u20, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q5SLP7  
Loading Protvista...
Molecule details ›

Search similar proteins

RNA chains AA, CA
Name: 16S ribosomal RNA
Representative chains: AA, CA
Length: 1539 nucleotides
Theoretical weight: 498.73 KDa
Rfam: Bacterial small subunit ribosomal RNA
16S ribosomal RNA in PDB entry 4u20, assembly 1, front view.
16S ribosomal RNA in PDB entry 4u20, assembly 1, side view.
16S ribosomal RNA in PDB entry 4u20, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

RNA chains BA, DA
Name: 23S ribosomal RNA
Representative chains: BA, DA
Length: 2903 nucleotides
Theoretical weight: 941.31 KDa
Rfam: Bacterial large subunit ribosomal RNA
23S ribosomal RNA in PDB entry 4u20, assembly 1, front view.
23S ribosomal RNA in PDB entry 4u20, assembly 1, side view.
23S ribosomal RNA in PDB entry 4u20, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

RNA chains BB, DB
Name: 5S ribosomal RNA
Representative chains: BB, DB
Length: 119 nucleotides
Theoretical weight: 38.48 KDa
Rfam: 5S ribosomal RNA
5S ribosomal RNA in PDB entry 4u20, assembly 1, front view.
5S ribosomal RNA in PDB entry 4u20, assembly 1, side view.
5S ribosomal RNA in PDB entry 4u20, assembly 1, top view.
Loading Protvista...
Molecule details ›

Search similar RNA

Quick links