› › Structure analysis

Crystal structure of Mdm35

X-ray diffraction
1.45Å resolution
PDB entry 4ytv coloured by chain, front view.
PDB entry 4ytv coloured by chain, side view.
PDB entry 4ytv coloured by chain, top view.
Source organism: Saccharomyces cerevisiae S288C
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Mitochondrial distribution and morphology protein 35
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 5771.87 Å2
Buried surface area: 294.54 Å2
Dissociation area: 100.6 Å2
Dissociation energy (ΔGdiss): -0.97 kcal/mol
Dissociation entropy (TΔSdiss): 0.9 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-129907

Macromolecules

Mitochondrial distribution and morphology protein 35
Chain: A
Length: 84 amino acids
Theoretical weight: 9.41 KDa
Source organism: Saccharomyces cerevisiae S288C
Expression system: Escherichia coli
UniProt:
  • Canonical: O60200 (Residues: 1-81; Coverage: 94%)
Gene names: MDM35, YKL053C-A
Pfam: Uncharacterised protein family (UPF0203)
InterPro: Mitochondrial distribution/morphology family 35/apoptosis
Mitochondrial distribution and morphology protein 35 in PDB entry 4ytv, assembly 1, front view.
Mitochondrial distribution and morphology protein 35 in PDB entry 4ytv, assembly 1, side view.
Mitochondrial distribution and morphology protein 35 in PDB entry 4ytv, assembly 1, top view.
PDBe-KB: UniProt Coverage View: O60200  
1841020304050607080
 
20406080GPHMGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQGIKPALDEAREEAPFENGGKL
UniProt
O60200
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Sequence conservation
Molecule details ›

Search similar proteins

Quick links