Interleukin-17A in PDB entry 5hi4 ‹ PDBe

Chains: A, B
Length: 132 amino acids
Theoretical weight: 15.15 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:

Canonical: Q16552 (Residues: 24-155; Coverage: 100%)

Gene names: CTLA8, IL17, IL17A
FASTA Sequence


    >pdb|5hi4|A B

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

5hi4:

WebGL does not seem to be available.

This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser.

For a list of supported browsers, refer to http://caniuse.com/#feat=webgl.