› › Structure analysis

Structure of the SH3 domain of MLK3 bound to peptide generated from phage display

X-ray diffraction
1.2Å resolution
PDB entry 5k26 coloured by chain, front view.
PDB entry 5k26 coloured by chain, side view.
PDB entry 5k26 coloured by chain, top view.
Source organism: Homo sapiens
Assembly composition:
homo dimer (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: Mitogen-activated protein kinase kinase kinase 11
hide full assembly name
Multimeric state: homo dimer
Accessible surface area: 9238.41 Å2
Buried surface area: 1677.86 Å2
Dissociation area: 761.8 Å2
Dissociation energy (ΔGdiss): -6.44 kcal/mol
Dissociation entropy (TΔSdiss): 10.33 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-172516

Macromolecules

Mitogen-activated protein kinase kinase kinase 11
Chains: A, B
Length: 86 amino acids
Theoretical weight: 9.36 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: Q16584 (Residues: 41-105; Coverage: 8%)
Gene names: MAP3K11, MLK3, PTK1, SPRK
Pfam: Variant SH3 domain
InterPro:
CATH: SH3 Domains
Mitogen-activated protein kinase kinase kinase 11 in PDB entry 5k26, assembly 1, front view.
Mitogen-activated protein kinase kinase kinase 11 in PDB entry 5k26, assembly 1, side view.
Mitogen-activated protein kinase kinase kinase 11 in PDB entry 5k26, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q16584  
1861020304050607080
 
20406080HMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGAIRINPNGTWSRQAETVES
UniProt
Q16584
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Ligand binding sites
Interaction interfaces
Molecule details ›

Search similar proteins

Quick links