› › Structure analysis

The crystal structure of the Human SNF5/INI1 domain

X-ray diffraction
2.102Å resolution
PDB entry 5l7a coloured by chain, front view.
PDB entry 5l7a coloured by chain, side view.
PDB entry 5l7a coloured by chain, top view.
Source organism: Homo sapiens
Assembly composition:
monomeric (preferred)
Entry contents: 1 distinct polypeptide molecule

Quick links

Assemblies

Assembly 1 (preferred)
Download    3D Visualisation
Assembly Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4428.85 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-171401
Assembly 2
Download    3D Visualisation
Assembly Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4431.48 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-171401
Assembly 3
Download    3D Visualisation
Assembly Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4746.26 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-171401
Assembly 4
Download    3D Visualisation
Assembly Name: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
hide full assembly name
Multimeric state: monomeric
Accessible surface area: 4864.67 Å2
Buried surface area: 0.0 Å2
Dissociation area: 0 Å2
Dissociation energy (ΔGdiss): 0 kcal/mol
Dissociation entropy (TΔSdiss): 0 kcal/mol
Symmetry number: 1
PDBe Complex ID: PDB-CPX-171401

Macromolecules

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Chains: A, B, C, D
Length: 72 amino acids
Theoretical weight: 8.14 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli BL21(DE3)
UniProt:
  • Canonical: Q12824 (Residues: 184-252; Coverage: 18%)
Gene names: BAF47, INI1, SMARCB1, SNF5L1
Pfam: SNF5 / SMARCB1 / INI1
InterPro: SNF5/SMARCB1/INI1
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5l7a, assembly 1, front view.
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5l7a, assembly 1, side view.
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 in PDB entry 5l7a, assembly 1, top view.
PDBe-KB: UniProt Coverage View: Q12824  
17210203040506070
 
204060GGSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDS
UniProt
Q12824
Chains
Domains
Secondary structure
Flexibility predictions
Early folding residue predictions
Sequence conservation
Molecule details ›

Search similar proteins

Quick links